DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K2C and fab1

DIOPT Version :9

Sequence 1:NP_001139730.1 Gene:PIP4K2C / 79837 HGNCID:23786 Length:421 Species:Homo sapiens
Sequence 2:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster


Alignment Length:308 Identity:69/308 - (22%)
Similarity:124/308 - (40%) Gaps:87/308 - (28%)


- Green bases have known domain annotations that are detailed below.


Human   125 SLTRNPPSESEG--SDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGN---TLLPQ 184
            ||.::...|:.|  |..||..:.|...|:||::|.|:.........|.:||.:|...   |||.:
  Fly  1564 SLCKSVQWEARGGKSGSRFCKTLDDRFVLKEMNSRDMTIFEPFAPKYFEYIDRCQQQQQPTLLAK 1628

Human   185 FLGMYRVSVDNEDSY----MLVMRNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTL-KDMD 244
            ..|::||||..:||:    ::||.|:| :...:..|:|||||..:|......:..|:..| :::.
  Fly  1629 IFGVFRVSVKKKDSFVERSVMVMENLF-YGCNIENKFDLKGSERNRLVDPSNQQGEIVLLDENLV 1692

Human   245 FLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEAPVREDESEV 309
            .::.::.:|:....|.:..:.::||..||.:..:||||||:|:.                     
  Fly  1693 QMSWSKPLYVLSHSKTVLRDAIQRDSSFLEKNLVMDYSLLVGLD--------------------- 1736

Human   310 DGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLID 374
                                                                 .:..|..:|:||
  Fly  1737 -----------------------------------------------------KKNGVLVLGIID 1748

Human   375 ILTQYDAKKKAAHAAK--TVKHGAGAEISTVHPEQYAKRFLDFITNIF 420
            .:..:...|:.....|  .:..|.|.:.:.|:||:|.:||:|.:...|
  Fly  1749 YIRTFTLDKRVESIIKGSGILGGKGKDPTVVNPERYKQRFIDAMDRYF 1796

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4K2CNP_001139730.1 Required for interaction with PIP5K1A. /evidence=ECO:0000269|PubMed:31091439 69..75
PIPKc 72..420 CDD:214623 68/306 (22%)
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264
DEP 329..397 CDD:214489
Fab1_TCP 464..717 CDD:239450
PIPKc 1413..1797 CDD:295374 69/308 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.