DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLMP and Ama

DIOPT Version :9

Sequence 1:NP_079045.1 Gene:CLMP / 79827 HGNCID:24039 Length:373 Species:Homo sapiens
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:244 Identity:54/244 - (22%)
Similarity:98/244 - (40%) Gaps:48/244 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    14 VGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEE 78
            |.::|...|.....||         :|     .|.:.|....:|.:...|: .|.|::.:  ..:
  Fly    43 VASVGDSVEFNCTVEE---------VG-----QLSVSWAKRPSESDTNSVV-LSMRNILS--LPD 90

Human    79 QKGRVAFASNFLAGDA--SLQIEPLKPSDEGRYTCKVKNSG-RYVWSHVILKVLVRP----SKPK 136
            |:..|........|.|  :.:|:.::.||.|.|.|:|..|. ..|...:.|::...|    :.||
  Fly    91 QRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTPK 155

Human   137 CELEGELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVL------L 195
            ..|   :|||.:|.|.|.::...:|.: .|.|      |...:.|..       |.:|      :
  Fly   156 STL---VTEGQNLELTCHANGFPKPTI-SWAR------EHNAVMPAG-------GHLLAEPTLRI 203

Human   196 QNLTMSYSGLYQCTAGNEAGK-ESCVVRVTVQYVQSIGMVAGAVTGIVA 243
            :::.....|.|.|.|.|..|: :..::||.|::...|.:....:..:|:
  Fly   204 RSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLMPNP_079045.1 IgV_CAR_like 13..127 CDD:409552 25/115 (22%)
Ig strand B 31..35 CDD:409552 0/3 (0%)
Ig strand C 48..52 CDD:409552 0/3 (0%)
Ig strand E 94..98 CDD:409552 1/5 (20%)
Ig strand F 108..113 CDD:409552 2/4 (50%)
Ig strand G 121..124 CDD:409552 0/2 (0%)
IG 144..225 CDD:214652 21/87 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..373
AmaNP_731114.2 I-set 33..143 CDD:254352 26/116 (22%)
Ig 37..127 CDD:299845 22/100 (22%)
IG_like 154..234 CDD:214653 24/96 (25%)
IGc2 161..223 CDD:197706 17/75 (23%)
I-set 254..330 CDD:254352
IGc2 254..322 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.