DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EHMT1 and set-11

DIOPT Version :9

Sequence 1:XP_011517323.1 Gene:EHMT1 / 79813 HGNCID:24650 Length:1301 Species:Homo sapiens
Sequence 2:NP_001364763.1 Gene:set-11 / 185242 WormBaseID:WBGene00018023 Length:278 Species:Caenorhabditis elegans


Alignment Length:281 Identity:95/281 - (33%)
Similarity:137/281 - (48%) Gaps:33/281 - (11%)


- Green bases have known domain annotations that are detailed below.


Human  1000 DSAPDRPSPVERIVSRDIARGYERIPIPCVNAVDSEP-------CPSNYKYVSQNCVTSPMNIDR 1057
            |.|..:|    .::..||::|.||..:|    |.|.|       ...|:||.|:....:.....|
 Worm    11 DVAKQQP----MVLYEDISQGCERFVVP----VYSNPRFFMDSSLFENFKYTSRIIDVAGQLACR 67

Human  1058 NITHLQYCVCIDDCSSSNCMC--GQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRN 1120
            :.:....|.|...| |:||.|  |...       :|..:....:.....:.|||..|:|...|.|
 Worm    68 SASPTFMCQCAGQC-STNCECSSGVFG-------EGGTVENMELLMWDTVRECNEYCNCALWCGN 124

Human  1121 RVVQNGLRARLQLYRTRD--MGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDNK 1183
            ||.|.|....:::: .||  .|||||:..||..|||:.||.||||.|.||..|.:.::||  :.|
 Worm   125 RVAQKGAMYPVEIF-ARDPWCGWGVRASVDIAFGTFIGEYAGELIDDEEAMDRHDSTFLF--ETK 186

Human  1184 DG-EVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGE 1247
            .| |...|||::.||.:|||||.|.||:....:...:..::...:.||:.:.|..||:|..||||
 Worm   187 VGSETLTIDAKYSGNYTRFINHSCAPNVKVANISWDYDKIQLIHMCFFTDKAIRKGEELTIDYGE 251

Human  1248 RFWDIKGKLFSCRCGSPKCRH 1268
            .:|  ..|.|.|.|.|.:||:
 Worm   252 AWW--ANKKFPCLCKSSECRY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EHMT1XP_011517323.1 None
set-11NP_001364763.1 PreSET 21..117 CDD:128744 26/107 (24%)
SET 75..270 CDD:394802 77/207 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161469856
Domainoid 1 1.000 96 1.000 Domainoid score I5047
eggNOG 1 0.900 - - E2759_KOG1082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753093at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm15202
orthoMCL 1 0.900 - - OOG6_105922
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R211
SonicParanoid 1 1.000 - - X1720
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.680

Return to query results.
Submit another query.