DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFPI2 and tag-290

DIOPT Version :9

Sequence 1:NP_006519.1 Gene:TFPI2 / 7980 HGNCID:11761 Length:235 Species:Homo sapiens
Sequence 2:NP_505945.1 Gene:tag-290 / 179593 WormBaseID:WBGene00009386 Length:219 Species:Caenorhabditis elegans


Alignment Length:216 Identity:53/216 - (24%)
Similarity:71/216 - (32%) Gaps:56/216 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    36 CLLPLDYG-PCRALLLR--YYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCR 97
            |..|.|.| .|......  :|:|...:.|:.|||.||.||.|.|.|.:.|.|||...:.......
 Worm    19 CTQPKDSGNVCSGSQAERSFYFDTRMKVCQPFLYSGCGGNENRFSTSKECRDACQNKKSSSTTES 83

Human    98 LQVSVDDQCEGS-------------------------------TEKYFFNLSSMTCEKFFSGGCH 131
            .....||..:.|                               ..||.....:..|.||.|    
 Worm    84 PDTISDDSADQSGSPNSPPFVPQGDGHDQWRKADICGSNYLIPNGKYITCSPNQACPKFHS---- 144

Human   132 RNRIENRFPDEATCM-GFCAPKKIPSFCYSPKDEGLCSANV---TRYYFNPRYRTCDAFTYTGCG 192
                         |: |.|.|.| ...|....|.|.....|   .|:.:|....:|..::|.|..
 Worm   145 -------------CVNGACCPSK-DYVCSLRDDNGSFMDGVEDRPRFSWNNDVHSCTRWSYYGAN 195

Human   193 GNDNNFVSREDCKRACAKALK 213
            ||.|||.:.:.|.:.|..:.|
 Worm   196 GNYNNFPNFQSCMKFCQDSKK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFPI2NP_006519.1 KU 34..86 CDD:238057 20/52 (38%)
Kunitz_BPTI 95..149 CDD:278443 11/85 (13%)
Kunitz_BPTI 157..204 CDD:278443 14/49 (29%)
tag-290NP_505945.1 Kunitz_BPTI 19..73 CDD:278443 21/53 (40%)
KU 156..211 CDD:197529 15/54 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I4351
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.