DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oct2 and CG33233

DIOPT Version :9

Sequence 1:NP_001107932.1 Gene:oct2 / 797890 ZFINID:ZDB-GENE-080204-92 Length:554 Species:Danio rerio
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:270 Identity:61/270 - (22%)
Similarity:111/270 - (41%) Gaps:40/270 - (14%)


- Green bases have known domain annotations that are detailed below.


Zfish   134 EDSWLADLNQVSLAGGFFIGALVTGYLADRFGRKSCF-IASIFGLGVSGTCIIFSPYYPLLLFFR 197
            |.:.||:    ||.||.....|..|:||||:|||... :|.:..|..|....:....|.|.: .|
  Fly    57 EKTLLAN----SLLGGMVASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYSLSV-IR 116

Zfish   198 CLQGFFAKGAWTATYVLIIEFFGSNNRKFVSVMSRTFYSLGLVLLPALA---------------Y 247
            .:.|.|.....:.....:.||.....|.....:......|.|:..|.:|               |
  Fly   117 IIVGTFLSAVASLQVGFLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMAILPNNFNVDLSSSY 181

Zfish   248 YIPSWRNLQLAMTLPTFIFLIYHWVIPESPRWLLSQRKTKEALSIVKSIAKCNKRSLPEDFHEMD 312
            .:..||.|.:...:|.::.|:...::||:|.:|:|..:..:||..:|.|.:.|::.    :.::|
  Fly   182 NLRVWRFLMMFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKK----WEDVD 242

Zfish   313 LLIEKQEEIMRP----------SYKDLFKTPKMRKH---TFILIYAWFT--GAVVFQGLVLRLGI 362
            :.:.:::.....          .||.||..|.:.|.   .|::...:||  |..::..::..:..
  Fly   243 ITLSEEKSSTNDQEGFWKTVWYEYKLLFSKPHVFKFFICLFLIFGIFFTSIGLGIWFPVIRNMDN 307

Zfish   363 TGDNVFLDFL 372
            :|.|...|.:
  Fly   308 SGSNRLCDLV 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oct2NP_001107932.1 2A0119 12..516 CDD:273328 61/270 (23%)
MFS 123..506 CDD:119392 61/270 (23%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 61/270 (23%)
MFS 23..>208 CDD:119392 37/155 (24%)
MFS 354..>482 CDD:304372
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588564
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.