DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IQCA1 and prx-6

DIOPT Version :9

Sequence 1:NP_001257514.1 Gene:IQCA1 / 79781 HGNCID:26195 Length:830 Species:Homo sapiens
Sequence 2:NP_504268.1 Gene:prx-6 / 266912 WormBaseID:WBGene00004195 Length:720 Species:Caenorhabditis elegans


Alignment Length:380 Identity:80/380 - (21%)
Similarity:145/380 - (38%) Gaps:93/380 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   426 YDPELIKEEKRKE-LQSEIRIQVDELMRQELKNLKLAVDRERERPVKAGKKKDKKKGKKGKKKEK 489
            :..|.:.|..||. ||..:..::...:.::.....||   |.|:.|        |.|||.|.:||
 Worm   381 FSAEFMDENDRKTWLQYYLNEKLANHVAKKTSGFTLA---ELEKLV--------KNGKKVKIEEK 434

Human   490 KAKKDKDLTADRTIESLYKELVEEGLLIQALKVNLSDYIGEYSYLGTTLRQVSIEPMPSLLDVRQ 554
            :             |.:|::|:::      ...|.:|.||     ...:..|..|.:..|.:.:|
 Worm   435 E-------------EKVYEDLIDK------RNSNFADAIG-----APKIPNVRWEDVGGLEETKQ 475

Human   555 LI------TLYGIWPLGSAAVHEKAPLVKSLLLAGPSGVGKKMLVHAICTETGANLFNLSSSNIA 613
            .:      .|:|          .:|.....::|.|..|.||.::..|:.||......::....:.
 Worm   476 TVLESIRTNLFG----------SRALKRSGIILYGSPGCGKTLIAKAVATEFKIAFLSVKGPELL 530

Human   614 GKYPGKNGLQMMLHAVFKVARQLQPSVVWIEDTEKTFYKKVPNAEKMNEPKRLKKHLPQILKLL- 677
            .||.|::  :..|..||:.|:|..|.|::.::.:.....:..|.:......|:...|...|..| 
 Worm   531 NKYVGQS--EENLRKVFERAKQASPCVIFFDEIDSLAPNRGRNGDSGGVIDRIVSQLLAELDKLH 593

Human   678 -KPDDRILIVGTTRRP------------FD--------AELQSFCKVYQKIILVPR--PDYASRY 719
             .|..::.::|.|.||            ||        .:::|..|:.:.:....|  .|...|.
 Worm   594 NSPLTKVFVMGATNRPDLLDNSLMTPGRFDKLVEVKPGEDVESKTKILEAVSRKMRFEEDVDLRE 658

Human   720 VLWKQIIERNGGVLTSALN-------VSCLAKVTDGFT--------QGHIVEVVK 759
            :..|...:.:|..|.|.::       |..:..:.||.|        |.|::|.||
 Worm   659 IASKVDEKMSGAQLFSIISNAGMAAIVETIQSIEDGKTENQSIRVAQRHLLESVK 713

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IQCA1NP_001257514.1 SpoVK <497..796 CDD:223540 62/308 (20%)
AAA 579..712 CDD:278434 32/154 (21%)
prx-6NP_504268.1 CDC48 <261..714 CDD:273521 80/380 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.