DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ASB13 and flip

DIOPT Version :10

Sequence 1:NP_078977.2 Gene:ASB13 / 79754 HGNCID:19765 Length:278 Species:Homo sapiens
Sequence 2:NP_001097672.1 Gene:flip / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster


Alignment Length:71 Identity:20/71 - (28%)
Similarity:31/71 - (43%) Gaps:12/71 - (16%)


- Green bases have known domain annotations that are detailed below.


Human     2 NQIKSNRELYLQYSASAPKLLAHVSKLLIFCRNSGI---SIPKGIRNIFEFTWEELINDPAVPTA 63
            |.|:|..:..:..:.|||...|.|.|.|:...:.|.   ::.:|..|.|        :||| |.|
  Fly    84 NNIQSVMDYIVLQNNSAPFRPAPVRKFLMLLSSQGWDKGNVSEGKENGF--------SDPA-PAA 139

Human    64 SEIQDL 69
            ..:..|
  Fly   140 RNLHKL 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ASB13NP_078977.2 ANK 1 18..47 9/31 (29%)
ANKYR 20..221 CDD:440430 14/53 (26%)
ANK repeat 20..49 CDD:293786 8/31 (26%)
ANK repeat 51..82 CDD:293786 6/19 (32%)
ANK 2 51..80 6/19 (32%)
ANK 3 84..113
ANK repeat 84..112 CDD:293786
ANK 4 116..145
ANK repeat 119..147 CDD:293786
ANK repeat 149..179 CDD:293786
ANK 5 149..178
ANK repeat 181..212 CDD:293786
ANK 6 181..210
SOCS_ASB13 237..278 CDD:239699
flipNP_001097672.1 ANKYR 109..317 CDD:440430 12/46 (26%)
ANK repeat 128..156 CDD:293786 8/27 (30%)
ANK repeat 158..189 CDD:293786
ANK repeat 192..223 CDD:293786
ANK repeat 225..256 CDD:293786
ANK repeat 258..290 CDD:293786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.