DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNIP1 and NiPp1

DIOPT Version :10

Sequence 1:NP_078976.2 Gene:SNIP1 / 79753 HGNCID:30587 Length:396 Species:Homo sapiens
Sequence 2:NP_611177.1 Gene:NiPp1 / 44748 FlyBaseID:FBgn0026402 Length:383 Species:Drosophila melanogaster


Alignment Length:159 Identity:43/159 - (27%)
Similarity:72/159 - (45%) Gaps:29/159 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   246 YSEPPEARIPKKRWRLYPFKNDEVLPVMYIHRQSAYLLGRHRRIADIPIDHPSCSKQHAVFQYRL 310
            |..|..|..|.....|...|:|:::..:.:..:..||.||:.::.|..|||.|||:.|:.|.|. 
  Fly     5 YDIPSWAGKPPTGLHLDVLKDDKLVQKLMVDEKRCYLFGRNSQMNDFCIDHASCSRVHSAFVYH- 68

Human   311 VEYTRADGTVGRRVK-PYIIDLGSGNGTFLNNKRIEPQRYYELKEKDVLKFGFSSREYVL----- 369
                       :.:. .|::||||.:|||:...|:|..:..:|:......||.|:|.|:|     
  Fly    69 -----------KHLNIAYLVDLGSTHGTFIGTLRLEAHKPTQLQINSTFHFGASTRNYILRERPS 122

Human   370 -----------LHESSDTSEIDRKDDEDE 387
                       |.|:||.:.:...:.:.|
  Fly   123 GHHSNIMEDLPLSETSDGALLGLPESQTE 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNIP1NP_078976.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..227
PRK12678 24..>208 CDD:237171
FHA_SNIP1 224..372 CDD:438770 39/142 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 373..396 3/15 (20%)
NiPp1NP_611177.1 FHA_PPP1R8 12..119 CDD:438726 35/118 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.