DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNIP1 and CG7706

DIOPT Version :10

Sequence 1:NP_078976.2 Gene:SNIP1 / 79753 HGNCID:30587 Length:396 Species:Homo sapiens
Sequence 2:NP_650742.2 Gene:CG7706 / 42244 FlyBaseID:FBgn0038640 Length:726 Species:Drosophila melanogaster


Alignment Length:231 Identity:64/231 - (27%)
Similarity:93/231 - (40%) Gaps:79/231 - (34%)


- Green bases have known domain annotations that are detailed below.


Human   206 VPRPGGNNKEK---EVPAKEKPSFELSGALLEDTNTFRGVVIKYSEPPEARIPK----------- 256
            :|:|.....||   |||| |.|                        ||..:|||           
  Fly    10 LPKPKVIITEKPRSEVPA-EPP------------------------PPPLKIPKTPKSSPAAVCP 49

Human   257 ---KRWRLYPFKND----EVL-------PVMYIHRQSAYLLGRHRRIADIPIDHPSCSKQHAVFQ 307
               .:|...|.:|.    |||       .|..:.:|:.:..||... .|:|..||:.|:.|.|.|
  Fly    50 YKVPKWSAPPAENQIYSFEVLKSGQIIDTVHQLQQQAVWTFGRLPE-NDVPAAHPTISRFHVVLQ 113

Human   308 YR-----LVEYTRADGTV------GRRVKP---YIIDLGSGNGTFLNNKRIEPQRYYELKEKDVL 358
            |:     ..|..:.|..:      .:..:|   ||.|:||.:|||||.:|:.|:.|..::...:|
  Fly   114 YKPKAPPKPETAKEDDEMEEEDEEPKNDQPEGWYIYDMGSTHGTFLNKQRVPPKVYIRMRVGHML 178

Human   359 KFGFSSREYVLLHESSDTSEIDRKDDEDEEEEEEVS 394
            |.|.|:|.|:|           :...||||.|.|:|
  Fly   179 KLGGSTRVYIL-----------QGPGEDEEPESELS 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNIP1NP_078976.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..227 10/23 (43%)
PRK12678 24..>208 CDD:237171 0/1 (0%)
FHA_SNIP1 224..372 CDD:438770 48/186 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 373..396 7/22 (32%)
CG7706NP_650742.2 FHA_Kanadaptin 65..191 CDD:438729 39/137 (28%)
DSRM_Kanadaptin 263..345 CDD:380685
PTZ00108 <316..699 CDD:240271
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.