Sequence 1: | NP_002351.1 | Gene: | MAFK / 7975 | HGNCID: | 6782 | Length: | 156 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001286639.1 | Gene: | maf-S / 37336 | FlyBaseID: | FBgn0034534 | Length: | 137 | Species: | Drosophila melanogaster |
Alignment Length: | 99 | Identity: | 54/99 - (54%) |
---|---|---|---|
Similarity: | 76/99 - (76%) | Gaps: | 2/99 - (2%) |
- Green bases have known domain annotations that are detailed below.
Human 22 PVLSDDELVSMSVRELNQHL--RGLTKEEVTRLKQRRRTLKNRGYAASCRIKRVTQKEELERQRV 84
Human 85 ELQQEVEKLARENSSMRLELDALRSKYEALQTFA 118 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
MAFK | NP_002351.1 | bZIP_Maf_small | 46..115 | CDD:269865 | 36/68 (53%) |
coiled coil | 46..115 | CDD:269865 | 36/68 (53%) | ||
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 51..76 | 21/24 (88%) | |||
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 79..93 | 4/13 (31%) | |||
maf-S | NP_001286639.1 | bZIP_Maf_small | 51..120 | CDD:269865 | 36/68 (53%) |
coiled coil | 59..110 | CDD:269865 | 29/50 (58%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165143694 | |
Domainoid | 1 | 1.000 | 102 | 1.000 | Domainoid score | I6837 |
eggNOG | 1 | 0.900 | - | - | E1_KOG4196 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 1 | 1.000 | - | - | H1770 | |
Inparanoid | 1 | 1.050 | 107 | 1.000 | Inparanoid score | I4930 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1395389at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0001412 | |
OrthoInspector | 1 | 1.000 | - | - | otm41661 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_108977 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR10129 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5055 |
SonicParanoid | 1 | 1.000 | - | - | X1287 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
15 | 14.790 |