DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LIN28A and CG9705

DIOPT Version :10

Sequence 1:NP_078950.1 Gene:LIN28A / 79727 HGNCID:15986 Length:209 Species:Homo sapiens
Sequence 2:NP_648920.1 Gene:CG9705 / 39875 FlyBaseID:FBgn0036661 Length:143 Species:Drosophila melanogaster


Alignment Length:66 Identity:22/66 - (33%)
Similarity:29/66 - (43%) Gaps:19/66 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    28 AARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEA 92
            :|||.:.|.:   .|:.|.|:...|.||:  |..||     ..|||.|.|.:         |||.
  Fly    46 SARALENPVV---TGMVKSFSRTKGHGFI--TPNAG-----GEDVFCHVSDI---------EGEY 91

Human    93 V 93
            |
  Fly    92 V 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LIN28ANP_078950.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 1/2 (50%)
CSD 42..112 CDD:278729 18/52 (35%)
Flexible linker 113..136
AIR1 <120..>183 CDD:227414
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..209
CG9705NP_648920.1 CSP_CDS 55..120 CDD:239905 18/57 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.