DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LIN28A and CNBP

DIOPT Version :10

Sequence 1:NP_078950.1 Gene:LIN28A / 79727 HGNCID:15986 Length:209 Species:Homo sapiens
Sequence 2:NP_611739.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster


Alignment Length:96 Identity:28/96 - (29%)
Similarity:39/96 - (40%) Gaps:24/96 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   111 GPGGV-----FCIGSERRPKGKSMQKRRSK-----------------GDRCYNCGGLDHHAKECK 153
            |||||     ...|..|...|..|::.|.|                 .:|||.|.|:.|.:|:|.
  Fly    27 GPGGVGGGGGGGGGGMRGNDGGGMRRNREKCYKCNQFGHFARACPEEAERCYRCNGIGHISKDCT 91

Human   154 LPPQPKKCHFCQSISHMVASCPLKA-QQGPS 183
            ....| .|:.|....|.|.:||... ::||:
  Fly    92 QADNP-TCYRCNKTGHWVRNCPEAVNERGPT 121

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
LIN28ANP_078950.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31