DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VPS37B and Vsp37A

DIOPT Version :10

Sequence 1:XP_011537045.1 Gene:VPS37B / 79720 HGNCID:25754 Length:344 Species:Homo sapiens
Sequence 2:NP_525034.2 Gene:Vsp37A / 31006 FlyBaseID:FBgn0016038 Length:200 Species:Drosophila melanogaster


Alignment Length:124 Identity:31/124 - (25%)
Similarity:59/124 - (47%) Gaps:12/124 - (9%)


- Green bases have known domain annotations that are detailed below.


Human   102 LNKEM-------TLASNRSLAEGNLLYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSS 159
            ||:|:       .:.|..:..:|..|.:     ||.||:..:..|:.|.|.......|..::|..
  Fly    70 LNEELDSMMDQVEIISRENECKGIHLVE-----LKRRLSDDFTALKNLGEKCDRLNKKYFKKSDE 129

Human   160 ASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKL 218
            .:.:.:..|||...:..:.|.:...|.||:|:..:.:|::.||..:|::..|:.|.|:|
  Fly   130 YAPQHIRELLQIAASNADGDCDRHVEHFLNGKTDVQTFLNTYQWSKKISTERKAKEERL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VPS37BXP_011537045.1 Mod_r 96..215 CDD:462117 28/119 (24%)
Vsp37ANP_525034.2 Mod_r 42..185 CDD:462117 28/119 (24%)

Return to query results.
Submit another query.