DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VTCN1 and side-V

DIOPT Version :9

Sequence 1:XP_011540445.2 Gene:VTCN1 / 79679 HGNCID:28873 Length:332 Species:Homo sapiens
Sequence 2:NP_611765.2 Gene:side-V / 37679 FlyBaseID:FBgn0085400 Length:1174 Species:Drosophila melanogaster


Alignment Length:272 Identity:53/272 - (19%)
Similarity:101/272 - (37%) Gaps:76/272 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    46 NVFFSAVRIRRSRKHSIISIIIILAGAIALIIGFGISGRHSIT-----VTTVASAGNIGEDGILS 105
            :.|.:||..|:.     ::.:::||.|::|:.|    .:|..|     ::.:.:|  :|.:..|.
  Fly     2 DTFSAAVFPRQP-----VAFVLVLATALSLVQG----EQHPATADEGPLSEILTA--VGSEVALP 55

Human   106 CTFEPDIKLSDIV--IQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRT----AVFADQVIVGN-- 162
            |...|...:.|.|  :.|.::|.:..::.|..            |||.    ..:||:.:...  
  Fly    56 CDLVPGTGIVDKVQLVIWYRQGNVKPIYTFDA------------RGRPLNLGIPWADESVFNKKA 108

Human   163 --------ASLRLKNVQLTDAGTYKCYI----------------------ITSKGKGNANLEYKT 197
                    .:||:||:|.:|||.|||.:                      :|......|.:..:|
  Fly   109 HFHHDTDPPALRIKNIQTSDAGLYKCRVDFHKSPTRNWRINVTVLVPPTALTILDHHGAEIRDQT 173

Human   198 GAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQ---VDQGANFSEVSNTSFELNSENVTMK 259
            ....:...::|       |.|.:....|.|.|.|..:   :|.........:....|..:|:..|
  Fly   174 AGPYLEGDSID-------LTCLSSGGVPPPRVSWWREHALIDDSFQVLPDGSVRNVLRLKNIQRK 231

Human   260 VVSVLYNVTINN 271
            .:..:|....:|
  Fly   232 DLLTMYTCQASN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VTCN1XP_011540445.2 None
side-VNP_611765.2 Ig 42..153 CDD:299845 26/124 (21%)
IG_like 42..152 CDD:214653 26/123 (21%)
IGc2 179..245 CDD:197706 13/72 (18%)
IG_like 179..245 CDD:214653 13/72 (18%)
Ig <282..348 CDD:299845
IGc2 400..459 CDD:197706
FN3 719..798 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.