Sequence 1: | XP_011540445.2 | Gene: | VTCN1 / 79679 | HGNCID: | 28873 | Length: | 332 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_611765.2 | Gene: | side-V / 37679 | FlyBaseID: | FBgn0085400 | Length: | 1174 | Species: | Drosophila melanogaster |
Alignment Length: | 272 | Identity: | 53/272 - (19%) |
---|---|---|---|
Similarity: | 101/272 - (37%) | Gaps: | 76/272 - (27%) |
- Green bases have known domain annotations that are detailed below.
Human 46 NVFFSAVRIRRSRKHSIISIIIILAGAIALIIGFGISGRHSIT-----VTTVASAGNIGEDGILS 105
Human 106 CTFEPDIKLSDIV--IQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRT----AVFADQVIVGN-- 162
Human 163 --------ASLRLKNVQLTDAGTYKCYI----------------------ITSKGKGNANLEYKT 197
Human 198 GAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQ---VDQGANFSEVSNTSFELNSENVTMK 259
Human 260 VVSVLYNVTINN 271 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
VTCN1 | XP_011540445.2 | None | |||
side-V | NP_611765.2 | Ig | 42..153 | CDD:299845 | 26/124 (21%) |
IG_like | 42..152 | CDD:214653 | 26/123 (21%) | ||
IGc2 | 179..245 | CDD:197706 | 13/72 (18%) | ||
IG_like | 179..245 | CDD:214653 | 13/72 (18%) | ||
Ig | <282..348 | CDD:299845 | |||
IGc2 | 400..459 | CDD:197706 | |||
FN3 | 719..798 | CDD:214495 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |