DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VTCN1 and fred

DIOPT Version :9

Sequence 1:XP_011540445.2 Gene:VTCN1 / 79679 HGNCID:28873 Length:332 Species:Homo sapiens
Sequence 2:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster


Alignment Length:257 Identity:54/257 - (21%)
Similarity:90/257 - (35%) Gaps:80/257 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    78 GFGISGRHSIT-------VTTVASAGNIGEDG---ILSC--TFEPDIKLSDIVIQWLKEGVLGLV 130
            |.|.:|...|.       :..:.|..:..|:|   ::.|  |..|    |.|.::|||||.    
  Fly   300 GLGKTGEKDIVLDVLYPPIVFIESKTHEAEEGETVLIRCNVTANP----SPINVEWLKEGA---- 356

Human   131 HEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYII------TSK--- 186
                        .|..:.|..             |.|.:|:...||.|.|..:      :||   
  Fly   357 ------------PDFRYTGEL-------------LTLGSVRAEHAGNYICRSVNIMQPFSSKRVE 396

Human   187 GKGNAN----LEYKTG-AFSMPEVNVDYNASSETLRCEA--PRWFPQPTVVWASQVD-------- 236
            |.||:.    :.::.| |:..|...|.:..:..||.|.|  |.| |.|...|...:|        
  Fly   397 GVGNSTVALLVRHRPGQAYITPNKPVVHVGNGVTLTCSANPPGW-PVPQYRWFRDMDGDIGNTQK 460

Human   237 ---QGANFSEV-----SNTSFELNSENV--TMKVVSVLYNVTINNTYSCMIENDIAKATGDI 288
               ||..:|..     |...:..::.|.  ..|:.:::..|.....:...::..:.:..||:
  Fly   461 ILAQGPQYSIPKAHLGSEGKYHCHAVNELGIGKIATIILEVHQPPQFLAKLQQHMTRRVGDV 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VTCN1XP_011540445.2 None
fredNP_608812.3 Ig 29..126 CDD:299845
IG_like 141..228 CDD:214653
Ig 147..228 CDD:299845
I-set 232..313 CDD:254352 4/12 (33%)
IGc2 250..302 CDD:197706 1/1 (100%)
IG_like 323..385 CDD:214653 22/94 (23%)
IGc2 330..385 CDD:197706 20/87 (23%)
Ig_2 416..501 CDD:290606 18/85 (21%)
IG_like 418..501 CDD:214653 18/83 (22%)
I-set 505..612 CDD:254352 2/18 (11%)
Ig 526..611 CDD:143165
IG_like 633..715 CDD:214653
Ig 635..713 CDD:143165
FN3 720..838 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.