DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VTCN1 and sax-3

DIOPT Version :9

Sequence 1:XP_011540445.2 Gene:VTCN1 / 79679 HGNCID:28873 Length:332 Species:Homo sapiens
Sequence 2:NP_001024990.1 Gene:sax-3 / 180637 WormBaseID:WBGene00004729 Length:1273 Species:Caenorhabditis elegans


Alignment Length:255 Identity:55/255 - (21%)
Similarity:101/255 - (39%) Gaps:72/255 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    57 SRKHSIISIIIILAGAI-----------ALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEP 110
            :||..:.:|:::|...|           .:||      .|.|.|  |.|.|:   ...|:|..:|
 Worm     3 NRKTLLCTILLVLQAVIRSFCEDASNLAPVII------EHPIDV--VVSRGS---PATLNCGAKP 56

Human   111 DIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRL------KN 169
                |...|.|           :|:|:..::.:::       |.:.::::...||.|      ||
 Worm    57 ----STAKITW-----------YKDGQPVITNKEQ-------VNSHRIVLDTGSLFLLKVNSGKN 99

Human   170 VQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSET----------LRCEAPRWF 224
            .:.:|||.|.|......|:..:|    .|:..:..:..|:.....|          |.|..||.|
 Worm   100 GKDSDAGAYYCVASNEHGEVKSN----EGSLKLAMLREDFRVRPRTVQALGGEMAVLECSPPRGF 160

Human   225 PQPTVVWASQVDQGANFSEVSNTSFELNSE-NVTMKVVSVLYNVTINNTYSCMIENDIAK 283
            |:|.|.|... |:.....::..  :.|:|: |:.:..|    :.:.:.||.|:..|.:.:
 Worm   161 PEPVVSWRKD-DKELRIQDMPR--YTLHSDGNLIIDPV----DRSDSGTYQCVANNMVGE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VTCN1XP_011540445.2 None
sax-3NP_001024990.1 Ig 30..129 CDD:299845 30/135 (22%)
I-set 31..121 CDD:254352 28/122 (23%)
I-set 135..223 CDD:254352 19/86 (22%)
Ig2_Robo 137..223 CDD:143201 19/84 (23%)
I-set 227..313 CDD:254352
Ig 244..313 CDD:299845
I-set 317..410 CDD:254352
Ig 331..411 CDD:299845
Ig 424..512 CDD:299845
I-set 432..512 CDD:254352
FN3 531..624 CDD:238020
FN3 659..747 CDD:238020
FN3 755..836 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.