DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF128 and HRD1

DIOPT Version :9

Sequence 1:NP_919445.1 Gene:RNF128 / 79589 HGNCID:21153 Length:428 Species:Homo sapiens
Sequence 2:NP_014630.1 Gene:HRD1 / 854149 SGDID:S000005373 Length:551 Species:Saccharomyces cerevisiae


Alignment Length:205 Identity:44/205 - (21%)
Similarity:70/205 - (34%) Gaps:78/205 - (38%)


- Green bases have known domain annotations that are detailed below.


Human   273 DGDSCAVCIE--LYKPNDLV--------RILTCNHIFHKTCVDPWLLEHRTCPMCKCDILKALGI 327
            |.:.|.:|::  ::.||...        :.|.|.||.|.:|:..|:...:|||:|:..:....|.
Yeast   345 DDNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGN 409

Human   328 EVD---VEDGSVSLQVPV-------------SNEI----------------------------SN 348
            .|.   ..:..::.|..|             :||:                            |.
Yeast   410 VVQTTFTSNSDITTQTTVTDSTGIATDQQGFANEVDLLPTRTTSPDIRIVPTQNIDTLAMRTRST 474

Human   349 SASS--------HEE-DNRSETASSGYA-SVQGTDEPPLEEHVQSTNESLQLVNHEANSVAVD-- 401
            |..|        |:. ||...::.|.|. .:..:||......|:.|.|     |||.||:..|  
Yeast   475 STPSPTWYTFPLHKTGDNSVGSSRSAYEFLITNSDEKENGIPVKLTIE-----NHEVNSLHGDGG 534

Human   402 -------VIP 404
                   |||
Yeast   535 EQIAKKIVIP 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF128NP_919445.1 PA_GRAIL_like 48..193 CDD:239037
RING-H2_RNF128_like 275..323 CDD:319716 15/57 (26%)
RING-H2 finger (C3H2C3-type) 277..317 CDD:319716 14/49 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 346..428 22/106 (21%)
HRD1NP_014630.1 HRD1 5..551 CDD:227568 44/205 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.