DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF128 and gol

DIOPT Version :9

Sequence 1:NP_919445.1 Gene:RNF128 / 79589 HGNCID:21153 Length:428 Species:Homo sapiens
Sequence 2:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster


Alignment Length:304 Identity:105/304 - (34%)
Similarity:160/304 - (52%) Gaps:43/304 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    45 AYLNVSWRVPHTGVNRTVWELSEEGVYGQDSPLEPVAGVLV---PPDGPGALNACNPHTNFTVPT 106
            |:||.|: |.|..:...:....|:..||:...|. |.|.|:   ..|......||.|:...|:  
  Fly    70 AFLNWSY-VEHGNMLCNMEFAQEQARYGEGKVLN-VTGRLIHITATDNFSDDYACTPYIRGTL-- 130

Human   107 VWGSTVQ---VSWLALIQRGGGCTFADKIHLAYERGASGAVIFN-----------FPG-TRNEVI 156
              |:.:.   .:|:||::| |.|||.:|:...|::.|:|.:|:|           ..| |||   
  Fly   131 --GAPIPDKGETWIALVRR-GRCTFEEKVKHVYQQNAAGVIIYNDKQVMQLEKMQIKGKTRN--- 189

Human   157 PMSHPGAVDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKKHGPWV---NHYSIFFVSVSFFII 218
                     |.|::.....|..:..::.:|..||:.|..|::....:   |..|:.|||:||.::
  Fly   190 ---------IAAVITYQNIGQDLSLTLDKGYNVTISIIEGRRGVRTISSLNRTSVLFVSISFIVL 245

Human   219 TAATVGYFIFYSARRLRNARAQSRKQRQLKADAKKAIGRLQLRTLKQGD-KEIGPDGDSCAVCIE 282
            ...::.:.|||..:|.|..:|:.::.|.|.:..||||.::..:|.|..| |::  |.|.||:|||
  Fly   246 MIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFSDEKDL--DSDCCAICIE 308

Human   283 LYKPNDLVRILTCNHIFHKTCVDPWLLEHRTCPMCKCDILKALG 326
            .|||.|.:|||.|.|.|||.|:||||:|||||||||.|:||..|
  Fly   309 AYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLKFYG 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF128NP_919445.1 PA_GRAIL_like 48..193 CDD:239037 41/162 (25%)
RING-H2_RNF128_like 275..323 CDD:319716 33/47 (70%)
RING-H2 finger (C3H2C3-type) 277..317 CDD:319716 28/39 (72%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 346..428
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 41/162 (25%)
UPF0233 226..>258 CDD:299753 10/31 (32%)
zf-RING_2 301..344 CDD:290367 30/42 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 87 1.000 Domainoid score I7982
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 218 1.000 Inparanoid score I3586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41809
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22765
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X295
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
99.030

Return to query results.
Submit another query.