DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF128 and H10E21.5

DIOPT Version :9

Sequence 1:NP_919445.1 Gene:RNF128 / 79589 HGNCID:21153 Length:428 Species:Homo sapiens
Sequence 2:NP_497129.1 Gene:H10E21.5 / 175169 WormBaseID:WBGene00019185 Length:473 Species:Caenorhabditis elegans


Alignment Length:224 Identity:79/224 - (35%)
Similarity:117/224 - (52%) Gaps:52/224 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   207 SIFFVSVSFFIITAATVGYFIFYSARRLRNARAQSRKQRQLKADAKKAIGRLQLRTLKQG-DKEI 270
            |:.|||:||.|:...::.:.:||..:|.|.|.|:.|.||:|...|:||:.|:...|:..| .:|:
 Worm   159 SVLFVSISFIILMVISLAWLVFYYVQRFRYAHAKDRLQRRLFNAARKALTRIPTMTITPGMTQEL 223

Human   271 GPDGDSCAVCIELYKPNDLVRILTCNHIFHKTCVDPWLLEHRTCPMCKCDILKALGIEVDV---- 331
            ..|   ||||::.|:..|::|:|.|.||:||:|:||||||||||||||.||||..|...|:    
 Worm   224 QSD---CAVCLDPYQLQDVIRLLPCKHIYHKSCIDPWLLEHRTCPMCKNDILKHFGYWNDIRNDI 285

Human   332 ----------EDGSVSL-------QVPVSNEISNSASSHEEDNRS---------ETASSGYASVQ 370
                      :|.::.|       |.|.::.||..|:|...|::.         .:.|.||    
 Worm   286 QMPTNSRGIADDFTIRLELGEQEHQAPSADVISPEANSDTSDSQGFSFDNSEHHHSESFGY---- 346

Human   371 GTDE--PPLEEHVQSTNESLQLVNHEANS 397
            ||..  ||            |||.:.:|:
 Worm   347 GTSSTVPP------------QLVLNASNA 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF128NP_919445.1 PA_GRAIL_like 48..193 CDD:239037
RING-H2_RNF128_like 275..323 CDD:319716 30/47 (64%)
RING-H2 finger (C3H2C3-type) 277..317 CDD:319716 25/39 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 346..428 16/63 (25%)
H10E21.5NP_497129.1 HRD1 <150..325 CDD:227568 67/168 (40%)
RING-H2_GRAIL 226..273 CDD:319582 31/49 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I5756
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm15229
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22765
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X295
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.970

Return to query results.
Submit another query.