| Sequence 1: | NP_078808.3 | Gene: | SPAG16 / 79582 | HGNCID: | 23225 | Length: | 631 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_649969.1 | Gene: | CG3909 / 41226 | FlyBaseID: | FBgn0027524 | Length: | 331 | Species: | Drosophila melanogaster |
| Alignment Length: | 230 | Identity: | 66/230 - (28%) |
|---|---|---|---|
| Similarity: | 110/230 - (47%) | Gaps: | 7/230 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Human 407 DKLATSSGDTTVKLWDLCKGDCIL---TFEGHSRAVWSCTWHSCGNFVASSSLDKTSKIWDVNS- 467
Human 468 ERCRCTLYGHTDSVNSIEFFPFSNTLLTSSADKTLSIWDARTGICEQSLYGHMHSINDAI-FDPR 531
Human 532 GHMIASCDACGVTKLWDFRKLLPIVSIDIGPSPGNEVNFDSSGRVLAQASGNGVIHLLDL-KSGE 595
Human 596 IHKLMGHENEAHTVVFSHDGEILFSGGSDGTVRTW 630 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| SPAG16 | NP_078808.3 | Prefoldin | 160..271 | CDD:298833 | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 266..332 | ||||
| WD40 | <341..631 | CDD:225201 | 66/230 (29%) | ||
| WD40 | 344..631 | CDD:238121 | 66/230 (29%) | ||
| WD 1 | 350..389 | ||||
| WD40 repeat | 355..392 | CDD:293791 | |||
| WD 2 | 392..431 | 9/26 (35%) | |||
| WD40 repeat | 398..434 | CDD:293791 | 9/29 (31%) | ||
| WD 3 | 434..473 | 16/39 (41%) | |||
| WD40 repeat | 439..475 | CDD:293791 | 14/36 (39%) | ||
| WD 4 | 476..515 | 9/38 (24%) | |||
| WD40 repeat | 482..516 | CDD:293791 | 8/33 (24%) | ||
| WD 5 | 518..557 | 8/39 (21%) | |||
| WD40 repeat | 523..559 | CDD:293791 | 8/36 (22%) | ||
| WD 6 | 560..600 | 9/40 (23%) | |||
| WD40 repeat | 565..600 | CDD:293791 | 8/35 (23%) | ||
| WD 7 | 601..630 | 11/28 (39%) | |||
| WD40 repeat | 607..630 | CDD:293791 | 9/22 (41%) | ||
| CG3909 | NP_649969.1 | WD40 | 52..323 | CDD:238121 | 66/230 (29%) |
| WD40 | <54..326 | CDD:225201 | 65/229 (28%) | ||
| WD40 repeat | 89..127 | CDD:293791 | 13/37 (35%) | ||
| WD40 repeat | 130..166 | CDD:293791 | 8/35 (23%) | ||
| WD40 repeat | 174..209 | CDD:293791 | 8/34 (24%) | ||
| WD40 repeat | 215..251 | CDD:293791 | 8/35 (23%) | ||
| WD40 repeat | 257..293 | CDD:293791 | 10/25 (40%) | ||
| WD40 repeat | 299..323 | CDD:293791 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||