DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EPM2A and puc

DIOPT Version :9

Sequence 1:NP_005661.1 Gene:EPM2A / 7957 HGNCID:3413 Length:331 Species:Homo sapiens
Sequence 2:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster


Alignment Length:161 Identity:36/161 - (22%)
Similarity:67/161 - (41%) Gaps:38/161 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   147 FNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIVQNSSGCNRYPEP 211
            ::|..|.|   |.:.|::.||: .|..:..:     .:|...|:|...:                
  Fly   127 YDIETHPA---SPVFPHLLLGN-GRDADDPS-----SVGANCVLNVTCQ---------------- 166

Human   212 MTPDTMIKLYREEGLAYIWMPTPDMSTEGRVQMLPQAVCLLHALLEKGHIVYVHCNAGVGRS-TA 275
             :|:..    ..:||.|:.:|..|...:...|...:|...:....:.|..|.:||:||:.|| |.
  Fly   167 -SPNES----HLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATI 226

Human   276 AVCGWLQYVMGW-NLRKVQYFLMAK--RPAV 303
            |:.    |||.: :|..::.:.:.|  ||.:
  Fly   227 AIA----YVMRYKSLSLLEAYKLVKVARPII 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EPM2ANP_005661.1 CBM20_laforin 1..129 CDD:99881
Substrate binding. /evidence=ECO:0000269|PubMed:25544560, ECO:0007744|PDB:4RKK 103..107
PTPc 158..304 CDD:304379 33/150 (22%)
Glucan phosphatase signature motif CXAGXGR. /evidence=ECO:0000305|PubMed:25544560, ECO:0000305|PubMed:26231210 266..272 3/5 (60%)
Substrate binding. /evidence=ECO:0000269|PubMed:25544560, ECO:0007744|PDB:4RKK 267..272 2/4 (50%)
pucNP_524273.1 DSPc 133..267 CDD:238073 34/155 (22%)
CDC14 <193..272 CDD:225297 19/65 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.