DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EPM2A and CG10089

DIOPT Version :9

Sequence 1:NP_005661.1 Gene:EPM2A / 7957 HGNCID:3413 Length:331 Species:Homo sapiens
Sequence 2:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster


Alignment Length:174 Identity:39/174 - (22%)
Similarity:70/174 - (40%) Gaps:44/174 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   156 HYSRILPNIWLGSCPRQVEHVTI---KLKHELGITAVMNFQTEWDIVQNSSGCNRYPEPMTPDTM 217
            |..::||.:::|:.....:|..:   |:.|.:.|                   :..|..:.||  
  Fly     4 HMGKVLPGLYVGNYRDSKDHAQLERFKISHIIAI-------------------HDSPRRLLPD-- 47

Human   218 IKLYREEGLAYIWMPTPDMSTEGRVQMLPQ--AVC--LLHAL-LEKGHIVYVHCNAGVGRSTAAV 277
             |.|    |..:...|||       |.|.|  :||  .:||. |.:|::: :||.||:.||....
  Fly    48 -KHY----LCVMASDTPD-------QNLSQYFSVCNDFIHAARLREGNVL-IHCLAGMSRSVTVA 99

Human   278 CGWLQYVMGWNLRKVQYFLMAKRPAVYIDEEALARAQEDFFQKF 321
            ..::......|.::....:.|.|.....:....::.||  |::|
  Fly   100 VAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQLQE--FEQF 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EPM2ANP_005661.1 CBM20_laforin 1..129 CDD:99881
Substrate binding. /evidence=ECO:0000269|PubMed:25544560, ECO:0007744|PDB:4RKK 103..107
PTPc 158..304 CDD:304379 34/153 (22%)
Glucan phosphatase signature motif CXAGXGR. /evidence=ECO:0000305|PubMed:25544560, ECO:0000305|PubMed:26231210 266..272 3/5 (60%)
Substrate binding. /evidence=ECO:0000269|PubMed:25544560, ECO:0007744|PDB:4RKK 267..272 2/4 (50%)
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 37/170 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.