DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BIRC7 and Bruce

DIOPT Version :10

Sequence 1:XP_054179986.1 Gene:BIRC7 / 79444 HGNCID:13702 Length:351 Species:Homo sapiens
Sequence 2:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster


Alignment Length:131 Identity:37/131 - (28%)
Similarity:53/131 - (40%) Gaps:42/131 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    84 MGSEELRLASF-------YDWPLTAEVPPELLAAAGFFH---TGHQDKVRCFFCYGGLQSWKRGD 138
            |.||.:|..:|       |.|.|     |:.:|.|||:|   :..:|:..||.|...|..|::.|
  Fly   245 MHSEAVRRQTFEKWPHMDYKWAL-----PDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTD 304

Human   139 DPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPT 203
            :||:||.:..|.|.|:   ||                        |....|..|:..:..|.||.
  Fly   305 EPWSEHERHSPLCPFV---KG------------------------EYTQNVPLSITYATNPALPA 342

Human   204 P 204
            |
  Fly   343 P 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BIRC7XP_054179986.1 BIR 88..155 CDD:237989 25/76 (33%)
BruceNP_001262460.1 BIR 251..321 CDD:459891 25/77 (32%)
BIRC6 3539..3664 CDD:463547
UBCc_BIRC6 4631..4835 CDD:467430
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.