DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFEB and Usf

DIOPT Version :9

Sequence 1:NP_001161299.2 Gene:TFEB / 7942 HGNCID:11753 Length:490 Species:Homo sapiens
Sequence 2:NP_572167.3 Gene:Usf / 31384 FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster


Alignment Length:379 Identity:69/379 - (18%)
Similarity:112/379 - (29%) Gaps:161/379 - (42%)


- Green bases have known domain annotations that are detailed below.


Human   117 KFAAHISPAQGSPKPP--------PAASPGVR--AGH---------------------VLSSSAG 150
            :|.:..|....|..|.        |.|.||:.  ..|                     :|:|..|
  Fly    12 EFGSSTSNTNTSTSPSSVNISNANPTAGPGLMTITNHHTADLSEALVHSSFANGQQSLILTSDTG 76

Human   151 NSAPNSPMAMLHIGSNPERELDD-----VIDNIMRLD-DVLGYINPEMQMPNTLPLSSSHLNVY- 208
            |...||..|.:.:....:...||     .|......| |:...:...:|:||.|.|.:. ..:| 
  Fly    77 NPLMNSQGAQIFLTICGDENSDDSQEYYTIKQEPGCDLDIHSLLPSNLQLPNNLQLPTG-CEIYL 140

Human   209 -------SSDPQVTAS-------------LVGVTSSS---------------CPADLTQKRELTD 238
                   ..:|...|:             |..||:||               .|.::......|.
  Fly   141 VKETGSLMGEPPTKAAIKLELDTLSEKPLLPSVTTSSSTQSAVITAQTVNPPIPGNINTTTSTTS 205

Human   239 ----------------------AESRALAKER-----------QKKDN-----HNLIERRRRFNI 265
                                  |::|:..:..           :|:|:     ||.:|||||..|
  Fly   206 TTTTTSVLYGSHGNGHGHGHAHAQARSQPESAGQTPSSKLEAYKKRDDKRRATHNEVERRRRDKI 270

Human   266 NDRIKELGMLIPK----------------------------------------ANDLDVRWNKGT 290
            |..|.:|..::|.                                        .||     :|..
  Fly   271 NSWIFKLKEMLPSLSSSSSFSEASTSPSTSGSTSTNGSSHSKGNASSSSGRAPPND-----SKSQ 330

Human   291 ILKASVDYIRRMQKDLQKSRELENHSRRLEMTNKQLWLRIQEL----EMQARVH 340
            ||..:.:||:.||.::...|:....:..|..:|:.|...:..|    ::|.|.|
  Fly   331 ILIKACEYIKSMQGEIDTLRDCLRETDSLRASNQALREELDRLKRQQQLQERFH 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFEBNP_001161299.2 MITF_TFEB_C_3_N 18..175 CDD:292573 18/93 (19%)
HLH 247..307 CDD:238036 23/115 (20%)
DUF3371 335..471 CDD:288684 3/6 (50%)
UsfNP_572167.3 HLH 255..343 CDD:278439 19/92 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.