DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnf13 and DMA1

DIOPT Version :9

Sequence 1:NP_957338.1 Gene:rnf13 / 793981 ZFINID:ZDB-GENE-040426-772 Length:377 Species:Danio rerio
Sequence 2:NP_011983.1 Gene:DMA1 / 856515 SGDID:S000001157 Length:416 Species:Saccharomyces cerevisiae


Alignment Length:313 Identity:61/313 - (19%)
Similarity:119/313 - (38%) Gaps:75/313 - (23%)


- Green bases have known domain annotations that are detailed below.


Zfish    18 IFTVQIFAFLNLLPVEADISAYSFDNKTENFDDLPARFGYRLPSEGLKGFLIGARPENACVPIEP 82
            :|::::..|:       |.|:.|..|:...||.:     .|....|.: .:||...|.....|..
Yeast   153 LFSIRLTPFI-------DTSSTSVANQGLFFDPI-----IRTAGAGSQ-IIIGRYTERVREAISK 204

Zfish    83 PPQRENLSSAFIVLIRRFDCNFDIKVLHAQKAGYKAAIVHNVDSDDLISMGSEDLDILKQIDIPS 147
            .|.:.:            ...|..||:......:|.        ||   .|:.   .||.:...|
Yeast   205 IPDQYH------------PVVFKSKVISRTHGCFKV--------DD---QGNW---FLKDVKSSS 243

Zfish   148 -VFIGEE---AANSLKEDYIYEKGGHVILMPDFSLPLEYYLIPFLIIVGICLILIVVFMITKFVQ 208
             .|:..:   :|::..:||:...|..:.|..||....|                 .::...|...
Yeast   244 GTFLNHQRLSSASTTSKDYLLHDGDIIQLGMDFRGGTE-----------------EIYRCVKMKI 291

Zfish   209 DRHRA---RRSRLRKDQLKKLP-IHKFKKGDSYDVCAICLDEYEEGERLRVLPCSHAYHCKCVDP 269
            :.:::   :.:...|:.|.::. :.|...|...:.|:|||::.:..:.:.:.||:|::|..||..
Yeast   292 ELNKSWKLKANAFNKEALSRIKNLQKLTTGLEQEDCSICLNKIKPCQAIFISPCAHSWHFHCVRR 356

Zfish   270 W--LTKTKKTCPVCK-----QKVVPSDGDSE---SDSDSVDSGGE-DNEVSEN 311
            .  :...:..||.|:     :..:.|:.:||   .|.|..|...: |.|::.|
Yeast   357 LVIMNYPQFMCPNCRTNCDLETTLESESESEFENEDEDEPDIEMDIDMEINNN 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnf13NP_957338.1 PA_C_RZF_like 23..180 CDD:239038 32/160 (20%)
zf-RING_2 238..282 CDD:290367 12/45 (27%)
DMA1NP_011983.1 FHA 121..308 CDD:224630 36/210 (17%)
RING-H2_Dmap_like 325..371 CDD:319372 12/45 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.