DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnf13 and rnf13

DIOPT Version :9

Sequence 1:NP_957338.1 Gene:rnf13 / 793981 ZFINID:ZDB-GENE-040426-772 Length:377 Species:Danio rerio
Sequence 2:NP_001008015.1 Gene:rnf13 / 493377 XenbaseID:XB-GENE-954771 Length:383 Species:Xenopus tropicalis


Alignment Length:349 Identity:254/349 - (72%)
Similarity:299/349 - (85%) Gaps:10/349 - (2%)


- Green bases have known domain annotations that are detailed below.


Zfish    25 AFLNLLPVEADISAYSFDNKTENFDDLPARFGYRLPSEGLKGFLIGARPENACVPIEPPP-QREN 88
            |.::|:||:||::||:.||.:..||||||||||||||:||||:::.|:|||||.||.||| .|:|
 Frog    25 AVIHLVPVQADVAAYTADNVSRTFDDLPARFGYRLPSDGLKGYIVTAKPENACQPISPPPLLRDN 89

Zfish    89 LSSAFIVLIRRFDCNFDIKVLHAQKAGYKAAIVHNVDSDDLISMGSEDLDILKQIDIPSVFIGEE 153
            .||.|||||:|.:||||:|||:|||||:|||:|:||||||||||||.|:|||||||||||||||.
 Frog    90 TSSVFIVLIKRLECNFDLKVLNAQKAGFKAAVVYNVDSDDLISMGSNDVDILKQIDIPSVFIGES 154

Zfish   154 AANSLKEDYIYEKGGHVILMPDFSLPLEYYLIPFLIIVGICLILIVVFMITKFVQDRHRARRSRL 218
            :|..|||::.:||||:::|:||.:||||||||||||||||||:|||:|||||||||||||||:||
 Frog   155 SARFLKEEFSWEKGGYIVLVPDLTLPLEYYLIPFLIIVGICLVLIVIFMITKFVQDRHRARRNRL 219

Zfish   219 RKDQLKKLPIHKFKKGDSYDVCAICLDEYEEGERLRVLPCSHAYHCKCVDPWLTKTKKTCPVCKQ 283
            |||||||||||||||||.|||||:||||||||::||:||||||||||||||||||||||||||||
 Frog   220 RKDQLKKLPIHKFKKGDEYDVCAVCLDEYEEGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQ 284

Zfish   284 KVVPSDGDSESDSDSVDSGGEDNEVSENTPLLRSLASTSAHSFGSMSASLSQHDAGSS------D 342
            |||||.|||||||   ||..|||||||||||||.:||.|..|||::|.|.||.:...|      |
 Frog   285 KVVPSQGDSESDS---DSSQEDNEVSENTPLLRPMASASTQSFGAISESHSQQNMMESSGEDEDD 346

Zfish   343 YDERSDSSDSEEEVTVETVVVQLQ 366
            .|:..||..|:||...|:||||||
 Frog   347 DDDEDDSDSSDEEHNTESVVVQLQ 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnf13NP_957338.1 PA_C_RZF_like 23..180 CDD:239038 105/155 (68%)
zf-RING_2 238..282 CDD:290367 39/43 (91%)
rnf13NP_001008015.1 PA_C_RZF_like 24..181 CDD:239038 106/156 (68%)
RING_Ubox 239..284 CDD:388418 40/44 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I18456
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H13493
Inparanoid 1 1.050 524 1.000 Inparanoid score I6211
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 1 1.000 - - FOG0001489
OrthoInspector 1 1.000 - - oto84228
Panther 1 1.100 - - LDO PTHR22765
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.160

Return to query results.
Submit another query.