DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snip1 and CG17168

DIOPT Version :9

Sequence 1:NP_001020641.1 Gene:snip1 / 793873 ZFINID:ZDB-GENE-041026-3 Length:374 Species:Danio rerio
Sequence 2:NP_001015254.1 Gene:CG17168 / 3354996 FlyBaseID:FBgn0039943 Length:421 Species:Drosophila melanogaster


Alignment Length:417 Identity:170/417 - (40%)
Similarity:241/417 - (57%) Gaps:64/417 - (15%)


- Green bases have known domain annotations that are detailed below.


Zfish     3 NRRRHRDSPVRDVK------TKIKQERLSPARPPRARRHS-SGSSRDSSSPAQRRRDSRSPVRRK 60
            :::|:::..:...:      ||:....||..:..:.|..: |.||.|||:.:::...|.....||
  Fly     2 SKQRNKEHELEQQRTGHEGDTKMSDRNLSKTKKIKQRATADSSSSSDSSNESKKSNHSSLSPNRK 66

Zfish    61 DRSPARRDRSSGRQQERSPRPRRSRSPHRNTEARIKREQ-DDPRGSESHRH--RERRD------D 116
            .|:..:|.|.|.:.||:    |..:..|.:.:...:|.: |.|..|.|||:  |:||:      :
  Fly    67 QRTAGKRQRDSSQSQEK----RHKQLTHPSEDVHEQRSKWDSPERSNSHRNSTRQRRNTRSRSRE 127

Zfish   117 SNDRRLKREAERPRQRD-------------------------RGREQDRQRGRIRDAHIQEQQQA 156
            .::|...|:.||.::||                         :.||:|||| |..:.....:.|:
  Fly   128 RSERERDRDCERNKERDYNMQSSKERWQRSPALRHRSRSSERKNRERDRQR-RPTERRPVRRSQS 191

Zfish   157 ERER-HNER---RRENRLRQEAQSGGAEEMLEFGGENNDESAPA-----AEKEKPNFELSGALVE 212
            .|:| |..|   :|..|.::...|...|:.....|:..||..||     .:||||||.|||||.|
  Fly   192 PRDRCHGGRDLDQRRQRNQRHNNSNKNEDDHYVWGKEVDEKVPAENDVPVDKEKPNFGLSGALTE 256

Zfish   213 DTNTFRGEVIKYNEPPEARIPKRRWRLYPFKNDEPLPVMYIHRQSAYLLGRLRKIADIPIDHPSC 277
            |||...|.|:||:||||||.|||||||||||.:..||.::|||||.:|:||.||:.|:.:|||||
  Fly   257 DTNKLNGVVVKYSEPPEARKPKRRWRLYPFKGETALPTLHIHRQSCFLVGRDRKVVDLAVDHPSC 321

Zfish   278 SKQHAVFQYRLVEFTRVDGTAGRRVKPYIIDLGSGNGTYLNNQRIEPQRYYELKEKDVLKFGFSS 342
            |||||..|||||.|.|.||:.|:||:.|:|||.|.|||:|||::|:.::||||.||||:||||||
  Fly   322 SKQHAALQYRLVPFEREDGSHGKRVRLYLIDLDSANGTFLNNKKIDARKYYELIEKDVIKFGFSS 386

Zfish   343 REYVLLHEFSDTTEVDAKKKEEEEEED 369
            ||||||||.|         ||::|::|
  Fly   387 REYVLLHENS---------KEDQEDDD 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snip1NP_001020641.1 FHA 236..339 CDD:238017 64/102 (63%)
FHA <253..344 CDD:224630 59/90 (66%)
CG17168NP_001015254.1 FHA 280..395 CDD:238017 76/114 (67%)
FHA <294..411 CDD:224630 72/120 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4583
eggNOG 1 0.900 - - E1_KOG1882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 280 1.000 Inparanoid score I2876
OMA 1 1.010 - - QHG52032
OrthoDB 1 1.010 - - D955935at2759
OrthoFinder 1 1.000 - - FOG0004489
OrthoInspector 1 1.000 - - oto41401
orthoMCL 1 0.900 - - OOG6_102703
Panther 1 1.100 - - LDO PTHR23308
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2234
SonicParanoid 1 1.000 - - X4267
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.