DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCRL2 and DIP-epsilon

DIOPT Version :9

Sequence 1:XP_016857805.1 Gene:FCRL2 / 79368 HGNCID:14875 Length:523 Species:Homo sapiens
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:231 Identity:61/231 - (26%)
Similarity:90/231 - (38%) Gaps:30/231 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   162 LQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHVQRIPI-SNVSLEIRAPGGQVTEGQKLILL 225
            |.|:.|..||.|.|.|:..|||       .::|....::.: .|:...:.:....|.||..:.|.
  Fly   122 LHINNVQEEDRGRYMCQINTVT-------AKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLR 179

Human   226 CSVAGGTGNVTFSWYREATGTSMGKKTQRSLSAE---LEIPAVKESDAGKYYCRADNGHVPIQSK 287
            |. |.|:...|..|.|:.....:..||......|   ||:..:.....|.|.|.|.||..|..||
  Fly   180 CK-AKGSPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSK 243

Human   288 VVNIPVRIPVSRPVLTLRSPGAQAAVGDLLELHCEALRGSPPIL-YQFYHEDVTLGNSSA----- 346
            .:.:.|..   .|::.:........:|..:.|.| .:..:|..| |.....|..:..||.     
  Fly   244 RIKVSVDF---SPMVWIPHQLVGIPIGFNITLEC-FIEANPTSLNYWTRENDQMITESSKYKTET 304

Human   347 ----PSGGGASFNLSLTAEHS---GNYSCEANNGLG 375
                || ..|:..|::|...|   |||.|.|.|..|
  Fly   305 IPGHPS-YKATMRLTITNVQSSDYGNYKCVAKNPRG 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCRL2XP_016857805.1 None
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 12/39 (31%)
Ig 69..139 CDD:143165 8/16 (50%)
IG_like 165..249 CDD:214653 24/84 (29%)
IGc2 172..237 CDD:197706 19/65 (29%)
IG_like 267..348 CDD:214653 22/75 (29%)
Ig 270..339 CDD:299845 20/70 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.