Sequence 1: | XP_016857805.1 | Gene: | FCRL2 / 79368 | HGNCID: | 14875 | Length: | 523 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
Alignment Length: | 229 | Identity: | 52/229 - (22%) |
---|---|---|---|
Similarity: | 90/229 - (39%) | Gaps: | 28/229 - (12%) |
- Green bases have known domain annotations that are detailed below.
Human 162 LQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHVQRIPISNVSLEIRAPGGQVT--EGQKLIL 224
Human 225 LCSVAGGTGNVTFSWYREATGTSMGKKTQRSLSAE---LEIPAVKESDAGKYYCRADNGHVPIQS 286
Human 287 KVVNIPVRIPVSRPVLTLRSP--GAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSG 349
Human 350 ---GGASFNLSLTAEH-----SGNYSCEANNGLG 375 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FCRL2 | XP_016857805.1 | None | |||
DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 8/39 (21%) |
Ig | 145..238 | CDD:416386 | 24/93 (26%) | ||
Ig strand A | 145..149 | CDD:409353 | 0/3 (0%) | ||
Ig strand A' | 154..159 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 165..172 | CDD:409353 | 1/7 (14%) | ||
Ig strand C | 178..183 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 185..187 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 203..209 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 216..223 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 230..238 | CDD:409353 | 2/7 (29%) | ||
Ig | 242..333 | CDD:416386 | 19/86 (22%) | ||
Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
Ig strand B | 259..266 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 272..277 | CDD:409353 | 2/4 (50%) | ||
Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 289..293 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 295..305 | CDD:409353 | 1/9 (11%) | ||
Ig strand F | 314..322 | CDD:409353 | 4/7 (57%) | ||
Ig strand G | 325..334 | CDD:409353 | 1/1 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |