DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCRL2 and side-VI

DIOPT Version :9

Sequence 1:XP_016857805.1 Gene:FCRL2 / 79368 HGNCID:14875 Length:523 Species:Homo sapiens
Sequence 2:NP_001036705.1 Gene:side-VI / 4379854 FlyBaseID:FBgn0083950 Length:1087 Species:Drosophila melanogaster


Alignment Length:454 Identity:95/454 - (20%)
Similarity:150/454 - (33%) Gaps:124/454 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   113 ASSFQP-------IEGGPVSLKCETRLSPQRLDVQLQFCFFRENQVL------------GSGW-- 156
            |..|:|       :......:||:.. |.|..|..|...:::.|..:            .|.|  
  Fly    25 ADGFKPDGEILRVLVNSSAQIKCDVG-SSQADDKVLLVVWYKNNLPIYSYDTRGAHAGTPSHWRD 88

Human   157 -------------SSSPELQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHV---QRIPISNV 205
                         ....||.|:.|..:|.|::.|:.:....:.|..::..::.|   |.|..:..
  Fly    89 EEVLEDRAVFRTHKEPAELIINPVKEKDAGNFRCRVDFKLSQTRNSNVNLEVVVPPTQPIIFNER 153

Human   206 SLEIRAPGGQVTEGQKLILLCSVAGGTGNVTFSWYREA-----------TGTSMGKKTQRSLSAE 259
            .|.|.:..|...||..|.:.|.|.||:...|..|....           .|....|...|:|| .
  Fly   154 RLRIDSRAGPYEEGGSLEVTCVVYGGSPPPTVIWLMNGQLQNSVVDYTYDGAINSKLVVRNLS-R 217

Human   260 LEIPAVKESDAGKYYCRADNGHVPIQSKVVNIPVRIPVSRPVLTLRSPGAQAAVGD-LLELHCEA 323
            :...||       |.|:|.|.|....:..:.|.:.:   ||:|...|...|....| ..|:.|:|
  Fly   218 IHQHAV-------YTCQASNFHKKYVATNITIDLYL---RPLLVEISFNNQPMSADRKYEIECQA 272

Human   324 LRGSPPILYQFYHEDVTL-GNSSAPS--GGGASFNLSLT---AEHSGNYSCEANNGLGAQCSEAV 382
            :...||....::..::.| |:|...|  |..::..||:|   .:|....||.|.|.|..      
  Fly   273 IGSRPPAKITWWMGNLELHGHSQKVSEDGNVSTSVLSITPTREDHGKALSCRATNELVR------ 331

Human   383 PVSISGPDGYRRDLMTAGVLWGLFGVLGFTGVALLLYALFHKISGESSATNEPRGASRPNPQEFT 447
                   :|.|...|...|.:          :..|...|                .|..||:   
  Fly   332 -------NGIRETAMKLNVFF----------IPTLQLDL----------------GSNLNPE--- 360

Human   448 YSSPTPDMEELQPVYVNVGSVDVDVVYSQVWS-----MQQPESSGLPSHLLFCEEIITLGGIRR 506
                  |:||...||...........|..||.     :|..:.:|    ::.....:.|.|:.|
  Fly   361 ------DIEEGDDVYFECKVHANPAAYKVVWKHNHQIIQHNQRAG----VIVSSGDLALQGVTR 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCRL2XP_016857805.1 None
side-VINP_001036705.1 IG_like 35..140 CDD:214653 17/105 (16%)
Ig_3 157..230 CDD:290638 21/80 (26%)
IG_like 165..242 CDD:214653 21/84 (25%)
Ig 265..343 CDD:299845 22/90 (24%)
IG_like 267..343 CDD:214653 22/88 (25%)
IG_like 363..440 CDD:214653 12/56 (21%)
IGc2 364..429 CDD:197706 11/55 (20%)
IG_like 456..532 CDD:214653
Ig_3 456..524 CDD:290638
fn3 545..622 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.