DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCRL2 and dpr2

DIOPT Version :9

Sequence 1:XP_016857805.1 Gene:FCRL2 / 79368 HGNCID:14875 Length:523 Species:Homo sapiens
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:275 Identity:48/275 - (17%)
Similarity:82/275 - (29%) Gaps:97/275 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    35 VLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQSAVLSDSGNYFCSTKGQLFLWDKTSNIVK 99
            :|....::.:|:.:.|   |:|:.::..|:       |...|||.|.|....:    .|.|...:
  Fly   153 ILTYTSDERFKVVRTA---DSKDWTLHVKY-------AQPRDSGIYECQVNTE----PKISMAFR 203

Human   100 IKVQELFQRPVLTASSFQPIEGGPVSLKCETRLSPQRLDVQLQFCFFRENQVLGSGWSSSPELQI 164
            :.|       ::|....:.|..||..|..:                      :||..:.:..::.
  Fly   204 LNV-------IVTPPDAKAIIAGPTDLYVK----------------------VGSSVTLTCHVKQ 239

Human   165 SAVWSEDTGS-YWCKAETVTHRIRKQSLQSQIHVQRIPISNVSLEIRAPGGQVTEGQKLILLCSV 228
            .|..::|.|. ||.:...:..........:.|.:|||                            
  Fly   240 PATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRI---------------------------- 276

Human   229 AGGTGNVTFSWYREATGTSMGKKTQRSLSAELEIPAVKESDAGKYYCRADNGHVPIQSKVVNI-- 291
                              ||.......|.:.|.|...:..|.|.|.|.......  .|.|||:  
  Fly   277 ------------------SMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAEA--ASVVVNVIN 321

Human   292 ---PVRIPVSRPVLT 303
               |..:..||.:.|
  Fly   322 DESPAAMQKSRAIRT 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCRL2XP_016857805.1 None
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 14/66 (21%)
Ig 116..192 CDD:299845 12/48 (25%)
ig 220..306 CDD:278476 21/153 (14%)
IG_like 220..306 CDD:214653 21/153 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.