DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BHLHE41 and cwo

DIOPT Version :9

Sequence 1:NP_110389.1 Gene:BHLHE41 / 79365 HGNCID:16617 Length:482 Species:Homo sapiens
Sequence 2:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster


Alignment Length:441 Identity:99/441 - (22%)
Similarity:155/441 - (35%) Gaps:137/441 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    37 KRDDTKDTYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTA 101
            :|:.|.....|.||:|||:||||:|.|:|.|..|:|...:....|.:||..::|:.::|||.|.:
  Fly    55 RRNKTSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKGRGRIEKTEIIEMAIRHLKHLQS 119

Human   102 LTEQQHQKIIALQNGERSLKSPIQSDLDAFHSGFQTCAKEVLQYLSRFESWTPREPRCVQLINHL 166
            ..:|:                  :||   :.||:..|.||..::|....    .:..|.:|:..|
  Fly   120 ECQQK------------------ESD---YRSGYMDCMKEAAKFLYDVH----MQDFCHRLLGRL 159

Human   167 HAVATQFLPT---PQLLTQQVP--LSKGTGAPSAAGSAAAPCLERAGQKLEPLAYCVPVIQRTQP 226
            .....:...|   ....:..:|  :|..:|:|..|..             .||.:...::..:..
  Fly   160 QEHIDEMFKTDCYKSTRSCHMPDNVSASSGSPHQAYH-------------PPLCHLRDMLATSAS 211

Human   227 SAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRMKLDSRGGGSGG 291
            ..|.:.:::...|..:..........::...|.|.                              
  Fly   212 DVEHSQDHNDVKDLSFRNHLNQLQRSQQAAAAAAV------------------------------ 246

Human   292 GPGGGAAAAAAALLGPDPAAAAALLRPDAALLSSLVAFGGGGGAPFPQPAAAAAPFCLPFCFLSP 356
                 ||||.|...|..||:.|.:   |:.:  .|...||.||||   |||...|        |.
  Fly   247 -----AAAAVAVANGSSPASNAGV---DSKV--PLTNGGGTGGAP---PAADNVP--------SN 290

Human   357 SAAAAYVQPFLDKSGLEKYLYPAAAAAPFPLLYPGIPAPAAAAAAAAAAAAAAAAFPCLSSVLSP 421
            |..:                                 ..|||.|...:.::.:.:....||.:.|
  Fly   291 STGS---------------------------------GSAAACAGGNSNSSGSNSSNAASSTICP 322

Human   422 P-----PEKAGAAAATLLPHEVAPL---GAPHPQHPH-GRTHLPFAGPREP 463
            |     |.|....||...||: ||:   .|||..|.| ..:|..|...|||
  Fly   323 PAGGSCPAKVTPLAAHQQPHQ-APVITSTAPHHHHHHTDSSHHDFESSREP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BHLHE41NP_110389.1 bHLH-O_DEC2 31..122 CDD:381593 27/84 (32%)
Necessary for interaction with RXRA and repressor activity towards RXRA. /evidence=ECO:0000269|PubMed:19786558 67..71 1/3 (33%)
ORANGE 129..175 CDD:128787 9/45 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..298 4/69 (6%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 438..482 12/30 (40%)
cwoNP_524775.1 HLH 66..118 CDD:306515 22/51 (43%)
ORANGE 126..168 CDD:128787 11/48 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140967
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.