DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BHLHE41 and E(spl)m5-HLH

DIOPT Version :9

Sequence 1:NP_110389.1 Gene:BHLHE41 / 79365 HGNCID:16617 Length:482 Species:Homo sapiens
Sequence 2:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster


Alignment Length:174 Identity:40/174 - (22%)
Similarity:77/174 - (44%) Gaps:33/174 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    41 TKDTYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQ 105
            |:...|:...|:|::||.|:|:|:..||.|:.|......:..::||.:||..|..::        
  Fly    15 TQHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAILRMDKAEMLEAALVFMR-------- 71

Human   106 QHQKIIALQNGERSLKSPIQS-DLDAFHSGFQTCAKEVLQYLSRFESWTPREPRCV--QLINHLH 167
              ::::..|       :|:.. .:|:|.:|:.....|:    ||..:.||.....|  .::.||.
  Fly    72 --KQVVKQQ-------APVSPLPMDSFKNGYMNAVSEI----SRVMACTPAMSVDVGKTVMTHLG 123

Human   168 AVATQFLPTPQLLTQQVPLSKGTGAPSAAG---------SAAAP 202
            ....:.|...|:.|.....:....:|:::|         |||:|
  Fly   124 VEFQRMLQADQVQTSVTTSTPRPLSPASSGYHSDNEDSQSAASP 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BHLHE41NP_110389.1 bHLH-O_DEC2 31..122 CDD:381593 19/80 (24%)
Necessary for interaction with RXRA and repressor activity towards RXRA. /evidence=ECO:0000269|PubMed:19786558 67..71 2/3 (67%)
ORANGE 129..175 CDD:128787 11/47 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..298
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 438..482
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 17/61 (28%)
ORANGE 87..131 CDD:128787 11/47 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140894
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.