DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment BHLHE41 and E(spl)mdelta-HLH

DIOPT Version :9

Sequence 1:	NP_110389.1	Gene:	BHLHE41 / 79365	HGNCID:	16617	Length:	482	Species:	Homo sapiens
Sequence 2:	NP_524503.2	Gene:	E(spl)mdelta-HLH / 43150	FlyBaseID:	FBgn0002734	Length:	173	Species:	Drosophila melanogaster

Alignment Length:	109	Identity:	38/109 - (34%)
Similarity:	58/109 - (53%)	Gaps:	13/109 - (11%)

- Green bases have known domain annotations that are detailed below.

Human    41 TKDTYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKL--TTLGHLEKAVVLELTLKHLKALTALT 103
            |:...|:...|:|:|||.|:|..:.:||||:.:.:..  ..:..||||.:||||:.:|||
  Fly    12 TQHYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKA----- 71

Human   104 EQQHQKIIALQNGERSLKSPIQSDLDAFHSGFQTCAKEVLQYLS 147
             ||.|::...|:     ..|.|.:||.|.:|:...|.||....|
  Fly    72 -QQQQRVANPQS-----PPPDQVNLDKFRAGYTQAAYEVSHIFS 109

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
BHLHE41	NP_110389.1	bHLH-O_DEC2	31..122	CDD:381593	28/82 (34%)
		Necessary for interaction with RXRA and repressor activity towards RXRA. /evidence=ECO:0000269\|PubMed:19786558	67..71		3/3 (100%)
		ORANGE	129..175	CDD:128787	7/19 (37%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	228..298
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	438..482
E(spl)mdelta-HLH	NP_524503.2	bHLH-O_ESMB_like	9..77	CDD:381584	27/70 (39%)
E(spl)mdelta-HLH	NP_524503.2	ORANGE	91..135	CDD:128787	7/19 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165140897
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4304
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR10985
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	4	3.840