DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4K5 and 5-HT7

DIOPT Version :9

Sequence 1:NP_001005483.1 Gene:OR4K5 / 79317 HGNCID:14745 Length:323 Species:Homo sapiens
Sequence 2:NP_001263131.1 Gene:5-HT7 / 43669 FlyBaseID:FBgn0004573 Length:564 Species:Drosophila melanogaster


Alignment Length:454 Identity:85/454 - (18%)
Similarity:154/454 - (33%) Gaps:182/454 - (40%)


- Green bases have known domain annotations that are detailed below.


Human     4 SNSSVV--------------SEFVLLGLCSSQKLQLFYFCFFSVLYTVIVL----GNLLIILTVT 50
            ||:::|              .||||..|.|         .|.|::..:::|    ||:|:.:.|.
  Fly   133 SNTTLVPLSDTPLLLEEFAAGEFVLPPLTS---------IFVSIVLLIVILGTVVGNVLVCIAVC 188

Human    51 SDTSLHSPMYFLLGNLSFVDICQASFATPKMIADFLSAHETISFSGCIAQIF--FIHLFTGGEMV 113
            ....|..|..:||.:|:..|:|.|....|  :|......|..:|...:..|:  |..|.....::
  Fly   189 MVRKLRRPCNYLLVSLALSDLCVALLVMP--MALLYEVLEKWNFGPLLCDIWVSFDVLCCTASIL 251

Human   114 LLVSMAYDRYVAICKPLYYVVIMSRRTCTVLVMISWAVSLVHTLSQLSFTVN-------LPFCGP 171
            .|.:::.|||:||.|||.|.|..:.|...:.|.|.|..:...:|..|....|       .|.|  
  Fly   252 NLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLILGNEHEDEEGQPIC-- 314

Human   172 NVVDSFFCDLPRVTKLACLDSYIIEILIVV----------------------------------- 201
            .|..:|...:     .|.|.|:.|.:.:::                                   
  Fly   315 TVCQNFAYQI-----YATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKRAQTHLQQALNGTGSPS 374

Human   202 -------------------------------------------------------NSGIL----- 206
                                                                   ::|:|     
  Fly   375 APQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAGHGSGGGVSGSTGLLGSPHH 439

Human   207 ------------SLSTFSLLVSSYIIILVTVWLKSSAAMAKAFSTLASHIAVVILFFGPCIFIYV 259
                        :.:|..:::|::.:..:..::   .|:.:.|.|:  |:               
  Fly   440 KKLRFQLAKEKKASTTLGIIMSAFTVCWLPFFI---LALIRPFETM--HV--------------- 484

Human   260 WPFTISPLDKFLAIFYTVFTPVLNPIIYTLRNRDMKAAVRKIVNHYLRPRRISEMSLVVRTSFH 323
             |.::|.|  ||.:.|.  ..:||||||...|||.:...::|:  |.   |.|.::.::|.:::
  Fly   485 -PASLSSL--FLWLGYA--NSLLNPIIYATLNRDFRKPFQEIL--YF---RCSSLNTMMRENYY 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4K5NP_001005483.1 7tm_4 31..301 CDD:304433 70/389 (18%)
7tm_1 41..287 CDD:278431 63/361 (17%)
5-HT7NP_001263131.1 7tm_4 173..>342 CDD:304433 46/177 (26%)
7tm_1 179..507 CDD:278431 63/361 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.