DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4K5 and SIFaR

DIOPT Version :9

Sequence 1:NP_001005483.1 Gene:OR4K5 / 79317 HGNCID:14745 Length:323 Species:Homo sapiens
Sequence 2:NP_001163674.1 Gene:SIFaR / 42530 FlyBaseID:FBgn0038880 Length:758 Species:Drosophila melanogaster


Alignment Length:340 Identity:65/340 - (19%)
Similarity:124/340 - (36%) Gaps:92/340 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    20 SQKLQLFYFCFFSVLYTVIVLGNLLIILTVTSDTSLHSPMYFLLGNLSFVDICQASFATPKMIAD 84
            |..:.:.|...:.|::.|.::||..:|..|.....:.:...:.:.||:..||....|..|..:..
  Fly   204 SLAMSMVYCVAYIVVFLVGLIGNSFVIAVVLRAPRMRTVTNYFIVNLAIADILVIVFCLPATLIG 268

Human    85 FLSAHETISFSGCIAQIFFIHLFTGGEMVLLVSMAYDRYVAICKPLYYVVIMSRRTCTVLVMISW 149
            .:.....:.:..|....:...:.....:..|::::.||::||..||..   |::|...::::..|
  Fly   269 NIFVPWMLGWLMCKFVPYIQGVSVAASVYSLIAVSLDRFIAIWWPLKQ---MTKRRARIMIIGIW 330

Human   150 AVSLVHTLSQLSFTVNLPFCGPNVVDSFFCDLPRVTKLACLDSY------IIEI----------L 198
            .::||.|:..|.|...:|      .:..|.|       |.:.:|      ..|:          .
  Fly   331 VIALVTTIPWLLFFDLVP------AEEVFSD-------ALVSAYSQPQFLCQEVWPPGTDGNLYF 382

Human   199 IVVNSGILSLSTFSLLVSSYIIILVTVWLKSSAAMAK-----------AFSTLASHIAVVILFFG 252
            ::.|.....|...||:...|::|.:.|..:|....:|           ....:...:|||||   
  Fly   383 LLANLVACYLLPMSLITLCYVLIWIKVSTRSIPGESKDAQMDRMQQKSKVKVIKMLVAVVIL--- 444

Human   253 PCIFIYVWPFTISPLDKFLAIFYTVFT--------------------PV----------LNPIIY 287
               |:..|    .||       |.:|.                    ||          :|||:|
  Fly   445 ---FVLSW----LPL-------YVIFARIKFGSDISQEEFEILKKVMPVAQWLGSSNSCINPILY 495

Human   288 TLRNRDMK--AAVRK 300
            ::..:..:  ||:.|
  Fly   496 SVNKKYRRGFAAIIK 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4K5NP_001005483.1 7tm_4 31..301 CDD:304433 63/329 (19%)
7tm_1 41..287 CDD:278431 57/302 (19%)
SIFaRNP_001163674.1 7tm_4 216..>443 CDD:304433 45/242 (19%)
7tm_1 225..495 CDD:278431 57/302 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.