DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4K5 and TrissinR

DIOPT Version :9

Sequence 1:NP_001005483.1 Gene:OR4K5 / 79317 HGNCID:14745 Length:323 Species:Homo sapiens
Sequence 2:NP_001097092.1 Gene:TrissinR / 33812 FlyBaseID:FBgn0085410 Length:669 Species:Drosophila melanogaster


Alignment Length:249 Identity:52/249 - (20%)
Similarity:110/249 - (44%) Gaps:30/249 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     2 DKSNSSVVSEFVLLGLCSSQKLQLFYFCFFSVLYTVIVLGNLLIILTVTSDTSLHSPMYFLLGNL 66
            |:.::...||::.    ....:::.:...:::::.....||||:||.||....|.|...|.|.||
  Fly   166 DEEDAEKASEYIF----DRTDVRIIFITLYTLVFCCCFFGNLLVILVVTLSRRLRSITNFFLANL 226

Human    67 SFVDICQASFATPKMIADFLSAHETISFSGCIAQIF-FIH-LFTGGEMVLLVSMAYDRYVAICKP 129
            :|.|.|...|...:.::.:|.  |:..|...:.::: |:| |.....:.:||.:..:||.||..|
  Fly   227 AFADFCVGLFCVMQNLSIYLI--ESWVFGEFLCRMYQFVHSLSYTASIFILVVICMERYFAIVHP 289

Human   130 LYYVVIMSRRTCTVLVMISWAVSLVHTLSQLSFTVNLPFCGPNVVDSFFCDLPRVTKLACLDSYI 194
            :....|::.....::::..|..|.|::..:..|:                  ..:..:...|...
  Fly   290 ITCKQILTAARLRMVIVTVWITSAVYSTPKFVFS------------------KTIKNIHTQDGQE 336

Human   195 IEILI----VVNSGILSLSTFSLLVSSYIIILVTVWLKSSAAMAKAFSTLASHI 244
            .||.:    :.||.:|.:..|.||....::::..::.|.:.|:.::...|..|:
  Fly   337 EEICVLDREMFNSKLLDMINFVLLYVMPLLVMTVLYSKIAIALWRSSRGLTPHV 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4K5NP_001005483.1 7tm_4 31..301 CDD:304433 49/220 (22%)
7tm_1 41..287 CDD:278431 49/210 (23%)
TrissinRNP_001097092.1 7tm_4 191..>327 CDD:304433 36/155 (23%)
7tm_1 201..>385 CDD:278431 47/203 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.