DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4K5 and CG32547

DIOPT Version :9

Sequence 1:NP_001005483.1 Gene:OR4K5 / 79317 HGNCID:14745 Length:323 Species:Homo sapiens
Sequence 2:NP_001259682.1 Gene:CG32547 / 3346150 FlyBaseID:FBgn0052547 Length:1008 Species:Drosophila melanogaster


Alignment Length:224 Identity:40/224 - (17%)
Similarity:81/224 - (36%) Gaps:38/224 - (16%)


- Green bases have known domain annotations that are detailed below.


Human     4 SNSSVVSEFVLLGLCSSQKLQLFYFCFFSVLYTVIVLG---NLLIILTVTSDTSLHSPMYFLLGN 65
            ||.:|..| .|.|......::..|:.|......:.:||   |::|::.:..........:..:.|
  Fly    79 SNGTVDME-RLSGPILKSSIKSVYWLFLIQYAALALLGVVLNVIIVVYIMYHRLYKDVTHAFIIN 142

Human    66 LSFVDICQASFATPKMIADFLSAH----ETISFSGCIAQIFFIHLFTGGEMVLLVSMAYDRYVAI 126
            |:.....|.:...|..:...|..:    :.:.|...:.|...:|:    .|:..:.:|:||...:
  Fly   143 LALCHFVQCALVLPVSLMVMLIQNWIFGQFLCFFLPMLQDIPLHV----AMISHILIAWDRMRWL 203

Human   127 CKPLYYVVIMSRRTCTVLVMISWAVSLVHTLSQLSFTV------------NLPFCGPNVVDSFFC 179
            ..||     ..|....|....:|...:|..|....:|:            .:..|..|::|    
  Fly   204 NDPL-----KGRLPGFVCCCATWLTGMVIALPYPIYTIYVELGDYMPQLSGIGLCVVNLMD---- 259

Human   180 DLPRVTK-----LACLDSYIIEILIVVNS 203
            |:...|:     :.|..:.::..|.:..|
  Fly   260 DMQEYTRGLFLLMYCGPAILLSYLYIRTS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4K5NP_001005483.1 7tm_4 31..301 CDD:304433 32/197 (16%)
7tm_1 41..287 CDD:278431 31/187 (17%)
CG32547NP_001259682.1 7TM_GPCR_Srd 104..>195 CDD:304638 14/94 (15%)
7tm_1 119..>292 CDD:278431 30/183 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.