DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4K5 and srsx-3

DIOPT Version :9

Sequence 1:NP_001005483.1 Gene:OR4K5 / 79317 HGNCID:14745 Length:323 Species:Homo sapiens
Sequence 2:NP_505041.1 Gene:srsx-3 / 190823 WormBaseID:WBGene00022408 Length:310 Species:Caenorhabditis elegans


Alignment Length:279 Identity:54/279 - (19%)
Similarity:109/279 - (39%) Gaps:52/279 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     6 SSVVSEFVLLGLCSSQKLQLFYFCFFSVLYTVI-VLGNLLIILTVTSDTSLHSPMYFLLGNLSFV 69
            ||.|:  ::..:|.|.::         |::.|: :.||:..:.......:|.|..|::...||..
 Worm     2 SSTVA--MINQICISTEI---------VVFNVLGLFGNINFLCLTYIKPALRSKSYYIQCALSVS 55

Human    70 DICQASFATPKMIADF--LSAHETISFSGCIAQIFFIHLFTGGEMVLLVSMAYDRYVAICKPLYY 132
            .|....|..|..:..|  :.....|.|......||||    ..:.|:::.:..|.::.:....:|
 Worm    56 HIFCLLFELPNAVLLFTGIQLRRNICFPAISLYIFFI----CAQAVIMLMLVVDLFIIVFFTTFY 116

Human   133 VVIMSRRTCTVLVMISWAVSLVHTLSQLSFTVNLPFCGPNVVDSFFCDLPRVTKLACLDSYIIEI 197
            ..|.:.....:::.|.:..|        :|||...|...:.....||:.|            |.:
 Worm   117 RRIENTTYTAMMLFIPFVYS--------AFTVAWGFVKMDDELVIFCNPP------------ISL 161

Human   198 LIVVNS--GILSLSTFSLLVSSYIIILVTVWL---KSSAAMAKAFSTLASHIAVVILFFGPCIFI 257
            ..||:.  .:.:::..|:.:..::.:::|...   |..:...|....|  .::||       :|:
 Worm   162 HPVVSRWWSMSNVALNSITLCLFLFLIITFHFRGKKQKSDTRKLMKRL--KVSVV-------VFV 217

Human   258 YVWPFTISPLDKFLAIFYT 276
            :.|......:|.|:||..|
 Worm   218 FSWYMCTLGVDLFVAIGMT 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4K5NP_001005483.1 7tm_4 31..301 CDD:304433 49/254 (19%)
7tm_1 41..287 CDD:278431 47/243 (19%)
srsx-3NP_505041.1 TM helix 1 17..38 CDD:341315 4/29 (14%)
7TM_GPCR_Srsx 21..277 CDD:255903 48/249 (19%)
TM helix 2 45..69 CDD:341315 6/23 (26%)
TM helix 3 81..111 CDD:341315 7/33 (21%)
TM helix 4 124..143 CDD:341315 5/26 (19%)
TM helix 5 170..191 CDD:341315 1/20 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.