DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4K5 and or70a14

DIOPT Version :9

Sequence 1:NP_001005483.1 Gene:OR4K5 / 79317 HGNCID:14745 Length:323 Species:Homo sapiens
Sequence 2:XP_009293934.1 Gene:or70a14 / 100534688 ZFINID:ZDB-GENE-081031-29 Length:312 Species:Danio rerio


Alignment Length:317 Identity:95/317 - (29%)
Similarity:171/317 - (53%) Gaps:16/317 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     1 MDKSNSSVVSEFVLL-GLCSSQKLQLFYFCFFSVLYTVIVLGNLLIILTVTSDTSLHSPMYFLLG 64
            ||  |.::.:..:|: ||..:.:.....|....::|..|::.|:.:|:.::::.:||.||:||..
Zfish     1 MD--NLTITNNILLVEGLKVAPQSSYPVFILLLLVYVFIMVSNIGLIVLISTEKNLHHPMHFLFC 63

Human    65 NLSFVDICQASFATPKMIADFL--SAHETISFSGCIAQIFFIHLFTGGEMVLLVSMAYDRYVAIC 127
            ||...||...:...|:::.|.|  |:...||::.|:.|.:|:|:|......:|:.||:|||||||
Zfish    64 NLPLNDIIGTNVILPRLMQDMLRESSERYISYAECVVQAYFVHVFAVACHYVLMIMAFDRYVAIC 128

Human   128 KPLYYVVIMSRRTCTVLVMISWAVSLVHTLSQLSFTVNLPFCGPNVVDSFFCDLPRVTKLACLDS 192
            .||.|..||:.:....|...:|.:|:......|..|:.|..| .:.:::.|||...:.||:| :|
Zfish   129 NPLRYSAIMTNKMVVKLSASAWGLSIFIVSILLGLTIRLSRC-RSYIENPFCDNASLFKLSC-ES 191

Human   193 YIIEIL--IVVNSGILSLSTFSLLVSSYIIILVTVWLKSSAAMAKAFSTLASHIAVVILFFGPC- 254
            .||..:  :|....:.:||..||.::...|..|.:..|:.:..:||..|.::||||.::.|..| 
Zfish   192 VIINNIFGMVYTVIVFTLSLGSLFITYGKIASVCITSKNKSLNSKAIKTCSTHIAVYLIMFISCA 256

Human   255 --IFIYVWPFTISPLDKFLAIFYTVFTPVLNPIIYTLRNRDMKAAVRKIVNHYLRPR 309
              ||::..| ..|...|..:|.:.:..|.|||::|.|:.::::   :|.|..:.|.:
Zfish   257 SFIFLHRVP-EYSDTRKLASIMFHIVPPGLNPLVYGLQTKEIR---QKFVKFWGRKK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4K5NP_001005483.1 7tm_4 31..301 CDD:304433 85/276 (31%)
7tm_1 41..287 CDD:278431 81/252 (32%)
or70a14XP_009293934.1 7tm_4 32..303 CDD:304433 86/276 (31%)
7tm_1 41..292 CDD:278431 82/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG38761
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.