DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4K5 and or70a13

DIOPT Version :9

Sequence 1:NP_001005483.1 Gene:OR4K5 / 79317 HGNCID:14745 Length:323 Species:Homo sapiens
Sequence 2:NP_001122057.1 Gene:or70a13 / 100151263 ZFINID:ZDB-GENE-070806-11 Length:314 Species:Danio rerio


Alignment Length:304 Identity:93/304 - (30%)
Similarity:165/304 - (54%) Gaps:16/304 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    19 SSQKLQLFYFCFFSVLYTVIVLGNLLIILTVTSDTSLHSPMYFLLGNLSFVDICQASFATPKMIA 83
            |||  .:|...|.|.::.:|  .|:.:|..::::.:||.||:||..||...||...:...|:::.
Zfish    22 SSQ--PVFIVLFLSYIFAMI--SNITLIFLISTEKNLHDPMHFLFCNLPVNDIIGTTVILPRLMQ 82

Human    84 DFL--SAHETISFSGCIAQIFFIHLFTGGEMVLLVSMAYDRYVAICKPLYYVVIMSRRTCTVLVM 146
            |.|  ::...||::.|:.|.:|:|:||.....:|:.||:|||||||.||.|..||:.:....|..
Zfish    83 DVLKEASERYISYTECVVQAYFVHVFTAACHYVLMIMAFDRYVAICNPLRYTAIMTNKMVIKLSA 147

Human   147 ISWAVSLVHTLSQLSFTVNLPFCGPNVVDSFFCDLPRVTKLACLDSYIIEILIVVNSGILS-LST 210
            .:|.::::.....:..|:.|..| .:.:::.|||...:.||:|.:..|.....||.|.|:: ||.
Zfish   148 SAWGLAIIVVTVMIGLTLRLSHC-RSTIENPFCDNASLFKLSCENVSINNAFGVVYSVIVACLSA 211

Human   211 FSLLVSSYIIILVTVWLKSSAAMAKAFSTLASHIAV-VILFFGPCIFIYVWPF-TISPLDKFLAI 273
            .|:.::...|..|.:..|:.|..:||..|.::|:|| :|:|....|||::..| ..:...|..:|
Zfish   212 ISIFITYVKIATVCLASKNKALNSKAMKTCSTHLAVYLIMFVSGAIFIFLHRFPEYAESRKLGSI 276

Human   274 FYTVFTPVLNPIIYTLRNRDMKAAVRKIVNHYLRPRRISEMSLV 317
            .:.:..|.|||::|.|:.::::....|:.      ||.:..||:
Zfish   277 MFHIVPPGLNPLVYGLQTKEIRQRFVKLC------RRKTSTSLM 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4K5NP_001005483.1 7tm_4 31..301 CDD:304433 83/274 (30%)
7tm_1 41..287 CDD:278431 79/250 (32%)
or70a13NP_001122057.1 7tm_4 32..304 CDD:304433 83/274 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG38761
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.