DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSD17B8 and CG31546

DIOPT Version :9

Sequence 1:NP_055049.1 Gene:HSD17B8 / 7923 HGNCID:3554 Length:261 Species:Homo sapiens
Sequence 2:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster


Alignment Length:253 Identity:72/253 - (28%)
Similarity:117/253 - (46%) Gaps:17/253 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    13 LALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVS 77
            :.|:|||.||||.|.:...:..||.:|..|.:.......::.....|.:   |.|    ...|:.
  Fly    15 VVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHE---PYG----IAGDLL 72

Human    78 EARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQAL 142
            :.....|:..:....:.....|:|:.|||.....|.......:..|:..|::..|.:|:.....|
  Fly    73 KPPEIECIARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLTKLLLPQL 137

Human   143 VSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMT 207
            :.  |:|||:|:||:.|.........|..|||.|...|::.|.:||..|:|.|:|.||.|.|.: 
  Fly   138 LQ--CKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRTNL- 199

Human   208 QKVPQKVVDKITEMI-------PMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGG 258
            ||..........|.:       .:|.:|:|::||..:.|||||.:.::||.::.|.||
  Fly   200 QKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVDGG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSD17B8NP_055049.1 BKR_SDR_c 13..260 CDD:187594 72/253 (28%)
CG31546NP_730973.1 fabG 9..257 CDD:235975 70/251 (28%)
NADB_Rossmann 11..261 CDD:304358 72/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.