DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnf150b and APE3

DIOPT Version :9

Sequence 1:NP_001017554.1 Gene:rnf150b / 792211 ZFINID:ZDB-GENE-050417-470 Length:419 Species:Danio rerio
Sequence 2:NP_009845.2 Gene:APE3 / 852589 SGDID:S000000490 Length:537 Species:Saccharomyces cerevisiae


Alignment Length:99 Identity:28/99 - (28%)
Similarity:43/99 - (43%) Gaps:8/99 - (8%)


- Green bases have known domain annotations that are detailed below.


Zfish    99 PRAHGAWIALISRGNCTYKDKIRHAVGHNASAVVIF-NVGSSNPNETITMPHQGISDVVAIMIPE 162
            ||.:...||||.||.|.:.||...|.....:||||: |...|......|:.......|..:.:|.
Yeast   198 PRHNEKQIALIERGKCPFGDKSNLAGKFGFTAVVIYDNEPKSKEGLHGTLGEPTKHTVATVGVPY 262

Zfish   163 PKGRELVLLMERNITVHMHIT-------IGTRNL 189
            ..|::|:..:..||...::..       |.|:|:
Yeast   263 KVGKKLIANIALNIDYSLYFAMDSYVEFIKTQNI 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnf150bNP_001017554.1 PA_GRAIL_like 45..182 CDD:239037 25/83 (30%)
UPF0233 <196..>221 CDD:299753
zf-RING_2 265..308 CDD:290367
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..419
APE3NP_009845.2 M28_SGAP_like 78..506 CDD:349873 28/99 (28%)
PA_ScAPY_like 155..284 CDD:239045 25/85 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000832
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.