DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnf150b and SPAP32A8.03c

DIOPT Version :9

Sequence 1:NP_001017554.1 Gene:rnf150b / 792211 ZFINID:ZDB-GENE-050417-470 Length:419 Species:Danio rerio
Sequence 2:NP_594179.1 Gene:SPAP32A8.03c / 2542072 PomBaseID:SPAP32A8.03c Length:513 Species:Schizosaccharomyces pombe


Alignment Length:69 Identity:25/69 - (36%)
Similarity:42/69 - (60%) Gaps:3/69 - (4%)


- Green bases have known domain annotations that are detailed below.


Zfish   240 AAKKAISQLQVRTIRKGDQETESDFDNCAVCIEGYKPNDVVRILPCRHLFHKCCVDPWLVDHRTC 304
            |.:..|::::|   :|..:|...:...|.:|:|.:|.||.|..|||:|.||:.|:.|||..:.||
pombe   372 APEDVIAKMKV---QKPPKELIDEEGECTICMEMFKINDDVIQLPCKHYFHENCIKPWLRVNGTC 433

Zfish   305 PMCK 308
            .:|:
pombe   434 AICR 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnf150bNP_001017554.1 PA_GRAIL_like 45..182 CDD:239037
UPF0233 <196..>221 CDD:299753
zf-RING_2 265..308 CDD:290367 19/42 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..419
SPAP32A8.03cNP_594179.1 HypA <1..34 CDD:302785
zf-RING_2 394..437 CDD:290367 19/42 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.