powered by:
Protein Alignment rnf150b and SPAP32A8.03c
DIOPT Version :9
Sequence 1: | NP_001017554.1 |
Gene: | rnf150b / 792211 |
ZFINID: | ZDB-GENE-050417-470 |
Length: | 419 |
Species: | Danio rerio |
Sequence 2: | NP_594179.1 |
Gene: | SPAP32A8.03c / 2542072 |
PomBaseID: | SPAP32A8.03c |
Length: | 513 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 69 |
Identity: | 25/69 - (36%) |
Similarity: | 42/69 - (60%) |
Gaps: | 3/69 - (4%) |
- Green bases have known domain annotations that are detailed below.
Zfish 240 AAKKAISQLQVRTIRKGDQETESDFDNCAVCIEGYKPNDVVRILPCRHLFHKCCVDPWLVDHRTC 304
|.:..|::::| :|..:|...:...|.:|:|.:|.||.|..|||:|.||:.|:.|||..:.||
pombe 372 APEDVIAKMKV---QKPPKELIDEEGECTICMEMFKINDDVIQLPCKHYFHENCIKPWLRVNGTC 433
Zfish 305 PMCK 308
.:|:
pombe 434 AICR 437
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.