DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTPAL and CG1902

DIOPT Version :10

Sequence 1:NP_077307.2 Gene:TTPAL / 79183 HGNCID:16114 Length:342 Species:Homo sapiens
Sequence 2:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster


Alignment Length:68 Identity:14/68 - (20%)
Similarity:31/68 - (45%) Gaps:23/68 - (33%)


- Green bases have known domain annotations that are detailed below.


Human   168 LTGFSTASPLYEECLRMNDGFSAYLLDVTEEDCFSLFPLETLVYLTPDSEHSLEDIDQSTVYVIG 232
            :|||::...||::.                .:|:. ||::.:::.|.:|    ..:|.|.  ::|
  Fly    77 ITGFASVKELYQKI----------------AECYD-FPMDEILFCTLNS----HKVDMSN--LLG 118

Human   233 GLV 235
            |.:
  Fly   119 GQI 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTPALNP_077307.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
CRAL_TRIO_N 56..102 CDD:215024
SEC14 128..277 CDD:469559 14/68 (21%)
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024
CRAL_TRIO 113..247 CDD:459890 3/11 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.