DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FBXL15 and CG5003

DIOPT Version :9

Sequence 1:XP_005270206.1 Gene:FBXL15 / 79176 HGNCID:28155 Length:387 Species:Homo sapiens
Sequence 2:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster


Alignment Length:272 Identity:62/272 - (22%)
Similarity:100/272 - (36%) Gaps:68/272 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   116 LPHVLNRVPLRQLLRLQRVSRAFRSLVQLHL----AGLRRFD----AAQVGPQIPRAALARLLRD 172
            |..|..||...::|.|:.||..|.   .:|:    |.|||..    :.:|| ..|::....:...
  Fly   160 LSSVFPRVVQLKVLELEGVSLDFE---YIHITEFPATLRRLKLKDCSVRVG-DTPKSIFYSIELH 220

Human   173 AEGLQELALAPCHEWLSDEDLVPVLARNPQLRSVALGGCGQLSRRA-LGALAE--GCPRLQRLSL 234
            ...|::|::.. :.|. :...:..|::.|.||.::|.||..|.:.. .|::|.  |..:|:.|.|
  Fly   221 LLDLEDLSIED-NSWF-EPYYIMGLSKLPSLRRLSLKGCQALCKFVPYGSMAARFGFQKLESLDL 283

Human   235 AHCDWVDGLALRGLADRCPALEELDL---TACRQLKDEAIVYLAQRRGAGLRSLSLAVNANVGDA 296
                            |...:...||   :|...||:     |.......|.|.......|....
  Fly   284 ----------------RQTPINNSDLQCFSAIENLKE-----LLLESPQILHSKQAVAKKNTNGN 327

Human   297 AVQELARNCPELHHLDLTGCLRVGSDG----VRTLAEYCPVLRSLRVR----HCHHVAESSLSRL 353
            |..|.|...|:        .|:|.||.    .|...|:   ||:.:|.    :|        |..
  Fly   328 ATDEAASPQPD--------SLKVLSDDEPSTSRAAMEH---LRACKVAFNLDNC--------SDR 373

Human   354 RKRGVDIDVEPP 365
            ::....:..|||
  Fly   374 KEEKSPVPTEPP 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FBXL15XP_005270206.1 F-box 105..>142 CDD:279040 9/25 (36%)
leucine-rich repeat 149..175 CDD:275381 6/29 (21%)
leucine-rich repeat 176..202 CDD:275381 4/25 (16%)
leucine-rich repeat 203..228 CDD:275381 9/27 (33%)
AMN1 <226..>353 CDD:187754 28/137 (20%)
leucine-rich repeat 229..254 CDD:275381 4/24 (17%)
leucine-rich repeat 255..281 CDD:275381 6/28 (21%)
leucine-rich repeat 282..307 CDD:275381 6/24 (25%)
leucine-rich repeat 308..332 CDD:275381 6/27 (22%)
CG5003NP_651593.1 F-box 68..114 CDD:279040
leucine-rich repeat 610..635 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153058
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.