Sequence 1: | XP_005270206.1 | Gene: | FBXL15 / 79176 | HGNCID: | 28155 | Length: | 387 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001303481.1 | Gene: | CG12402 / 41714 | FlyBaseID: | FBgn0038202 | Length: | 671 | Species: | Drosophila melanogaster |
Alignment Length: | 287 | Identity: | 72/287 - (25%) |
---|---|---|---|
Similarity: | 115/287 - (40%) | Gaps: | 64/287 - (22%) |
- Green bases have known domain annotations that are detailed below.
Human 114 VLLPHVLNRV----PLRQLLRLQRVSRAFRSLVQLHLAG-----LRRFD---AAQVGPQIPRAAL 166
Human 167 ARLLRDAEG-LQELALAPCHE---------------------------WLSDEDLVPVLARNPQL 203
Human 204 RSVALGGCGQ-LSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLAD------RCPALEELDLT 261
Human 262 ACRQLKDEAIVYLAQRRGAGLRSLSLAVNANVGDAAVQELARNCPELHHLDLTGCLRVGSDGVRT 326
Human 327 LAEYCPVLRSLRVRHC--------HHV 345 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FBXL15 | XP_005270206.1 | F-box | 105..>142 | CDD:279040 | 11/31 (35%) |
leucine-rich repeat | 149..175 | CDD:275381 | 6/28 (21%) | ||
leucine-rich repeat | 176..202 | CDD:275381 | 8/52 (15%) | ||
leucine-rich repeat | 203..228 | CDD:275381 | 6/25 (24%) | ||
AMN1 | <226..>353 | CDD:187754 | 35/134 (26%) | ||
leucine-rich repeat | 229..254 | CDD:275381 | 7/30 (23%) | ||
leucine-rich repeat | 255..281 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 282..307 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 308..332 | CDD:275381 | 5/23 (22%) | ||
CG12402 | NP_001303481.1 | F-box | 75..117 | CDD:279040 | |
leucine-rich repeat | 281..303 | CDD:275381 | |||
LRR_RI | <297..482 | CDD:238064 | 41/172 (24%) | ||
leucine-rich repeat | 304..330 | CDD:275381 | 6/13 (46%) | ||
leucine-rich repeat | 331..357 | CDD:275381 | 8/27 (30%) | ||
leucine-rich repeat | 358..379 | CDD:275381 | 5/25 (20%) | ||
leucine-rich repeat | 384..409 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 412..437 | CDD:275381 | 3/24 (13%) | ||
AMN1 | 430..595 | CDD:187754 | 44/166 (27%) | ||
leucine-rich repeat | 438..464 | CDD:275381 | 6/25 (24%) | ||
leucine-rich repeat | 465..496 | CDD:275381 | 7/30 (23%) | ||
leucine-rich repeat | 497..521 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 522..547 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 548..573 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 574..599 | CDD:275381 | 6/20 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR13318 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |