DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FBXL15 and CG8272

DIOPT Version :9

Sequence 1:XP_005270206.1 Gene:FBXL15 / 79176 HGNCID:28155 Length:387 Species:Homo sapiens
Sequence 2:NP_001260812.1 Gene:CG8272 / 35875 FlyBaseID:FBgn0033337 Length:710 Species:Drosophila melanogaster


Alignment Length:278 Identity:64/278 - (23%)
Similarity:110/278 - (39%) Gaps:73/278 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   136 RAFRSLVQLHLAGLRRFDAAQVGPQIPRAALAR-------------------------------- 168
            |..|.|...|.:||.  |||..|..|.:..::|                                
  Fly   425 RWLRELSLEHCSGLT--DAALTGINISKLEMSRKQSGSQVSSMDNFYPPYSNTLAERDSLAGSLQ 487

Human   169 -------------LLRDAEGLQELALAPCHEWLSDEDLVPVLARNPQ----LRSVALGGCGQLSR 216
                         ::|||...|.:..|.....:.::|..   ..|.|    |||:.|.||.::|.
  Fly   488 SIKISLRSKAEDEIVRDARRKQAMLAAYEMNLIREDDFE---GHNIQQLRGLRSLNLRGCNKISD 549

Human   217 RALGALAEGCP--RLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLKDEAIVYLAQRRG 279
               .:|..|..  .|:||.|::|..:..|.:..:|..||::|||||:.|..:.|:.|..:..:. 
  Fly   550 ---VSLKYGLKHIELRRLMLSNCQQISLLGMEAMASSCPSIEELDLSDCYNITDKTIQVVTSKL- 610

Human   280 AGLRSLSLAVNANVGDAAVQELARNCPELHHLDLTGCLRVGSD------GVRTLAEYCPVLRSLR 338
            ..|::|.::..:.:.:..:..:..||..|..|.:..|..:.:|      ||:|       ||:|.
  Fly   611 PRLKALHISGCSQLTEHTLDAIITNCSCLQTLSIYRCRSMYTDLEERLSGVKT-------LRNLN 668

Human   339 VRHCHHVAESSLSRLRKR 356
            :.:...:..:...||:||
  Fly   669 MDNLTSIDNAEFFRLKKR 686

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
FBXL15XP_005270206.1 F-box 105..>142 CDD:279040 2/5 (40%)
leucine-rich repeat 149..175 CDD:275381 10/70 (14%)
leucine-rich repeat 176..202 CDD:275381 4/25 (16%)
leucine-rich repeat 203..228 CDD:275381 9/26 (35%)
AMN1 <226..>353 CDD:187754 31/134 (23%)
leucine-rich repeat 229..254 CDD:275381 8/24 (33%)
leucine-rich repeat 255..281 CDD:275381 8/25 (32%)
leucine-rich repeat 282..307 CDD:275381 4/24 (17%)
leucine-rich repeat 308..332 CDD:275381 7/29 (24%)
CG8272NP_001260812.1 AMN1 269..440 CDD:187754 6/16 (38%)
leucine-rich repeat 270..295 CDD:275381
leucine-rich repeat 296..319 CDD:275381
leucine-rich repeat 322..346 CDD:275381
leucine-rich repeat 347..399 CDD:275381