DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ALDH5A1 and CG11634

DIOPT Version :10

Sequence 1:NP_733936.1 Gene:ALDH5A1 / 7915 HGNCID:408 Length:548 Species:Homo sapiens
Sequence 2:NP_610128.2 Gene:CG11634 / 35434 FlyBaseID:FBgn0032968 Length:298 Species:Drosophila melanogaster


Alignment Length:141 Identity:33/141 - (23%)
Similarity:51/141 - (36%) Gaps:28/141 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   790 QSEDILESYENPPPIVLPSQGFQVDL-EADCVEDSIYQHLLYIRHFLWGLRG--QASPDSGPA-- 849
            :.:.:...|..||.|...|..:|:.| :|......|.:....:..|.:.|.|  .||.|..||  
  Fly     4 EEKRVSSGYAKPPWIFKGSALYQIHLVKAATARAFIPKEFRLVEAFGYTLGGFFLASYDDSPAGV 68

Human   850 --QPESIEGAIMDTWAIPSS--GPQRLSTFSSQGLYHTIPEGHLEGHGCPLANRDPGRVAVETAP 910
              :...|.|.:   |..|:|  ...|:...|.:..:|...|..|           |.:||     
  Fly    69 FDELVVIAGIV---WNPPTSCAWAARVLVNSDEACHHGRKEVGL-----------PSQVA----- 114

Human   911 PHSLPVTGAPR 921
            ..|..:|..|:
  Fly   115 RFSKNITAVPK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ALDH5A1NP_733936.1 SSADH 78..541 CDD:188167
CG11634NP_610128.2 DUF1487 64..279 CDD:254173 18/81 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.