DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBLN and CG14818

DIOPT Version :10

Sequence 1:NP_077017.1 Gene:BBLN / 79095 HGNCID:17823 Length:83 Species:Homo sapiens
Sequence 2:NP_569955.1 Gene:CG14818 / 31147 FlyBaseID:FBgn0026088 Length:96 Species:Drosophila melanogaster


Alignment Length:94 Identity:27/94 - (28%)
Similarity:48/94 - (51%) Gaps:22/94 - (23%)


- Green bases have known domain annotations that are detailed below.


Human     2 SGPNGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQT 66
            ||.:|:..:. ||..:..||         :|:.||.::..||.:|::.|.:.::|:|||.|||:.
  Fly    12 SGDSGNTNVQ-EADLQEMED---------VNNSLDALSCALDAVEQRTDDIMSQLRELLNSNREI 66

Human    67 RLEFQQQL------------GEAPSDASP 83
            |....::.            |:|.|:|:|
  Fly    67 RRLIAEENDNAPESGDDNMDGQAGSEAAP 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBLNNP_077017.1 UPF0184 1..83 CDD:112485 26/92 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 7/21 (33%)
CG14818NP_569955.1 UPF0184 1..83 CDD:112485 22/80 (28%)

Return to query results.
Submit another query.